DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and Stom

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:NP_038543.1 Gene:Stom / 13830 MGIID:95403 Length:284 Species:Mus musculus


Alignment Length:269 Identity:163/269 - (60%)
Similarity:211/269 - (78%) Gaps:7/269 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 RVPGTTQQYRGFKTSENEPKGCMEWVVTLFSVLIFIITSPIAIFICFKVVAEYERAIIFRLGR-L 106
            |:|      ..|:.:.....|...|::...|....|||.||:|:||.|:|.||||.||||||| |
Mouse    14 RIP------ESFRENSKTELGACGWILVAASFFFVIITFPISIWICIKIVKEYERVIIFRLGRIL 72

  Fly   107 SGGARGPGMFFILPCIDEYRKVDLRTVTFNVPQQEMLTKDSVTVTVDAVVYYRISDPLYAVIQVE 171
            .|||:|||:||||||.|...|||:||::|::|.||:|||||||::||.|||||:.:...||..:.
Mouse    73 QGGAKGPGLFFILPCTDSLIKVDMRTISFDIPPQEVLTKDSVTISVDGVVYYRVQNATLAVANIT 137

  Fly   172 DYSMSTRLLAATTLRNIVGTRNLSELLTERETLAHNMQATLDEATEPWGVMVERVEIKDVSLPVS 236
            :...:|||||.|||||.:||:|||::|::||.:||:||:|||:||:.||:.|||||||||.|||.
Mouse   138 NADSATRLLAQTTLRNALGTKNLSQILSDREEIAHHMQSTLDDATDDWGIKVERVEIKDVKLPVQ 202

  Fly   237 MQRAMAAEAEAARDARAKVIAAEGEKKSATALKEASDVISASPSALQLRYLQTLSSISAEKNSTI 301
            :||||||||||||:|||||||||||..::.||||||.||:.||:||||||||||::|:|||||||
Mouse   203 LQRAMAAEAEAAREARAKVIAAEGEMNASRALKEASMVITESPAALQLRYLQTLTTIAAEKNSTI 267

  Fly   302 IFPLPMELL 310
            :||||:::|
Mouse   268 VFPLPVDML 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 94/150 (63%)
SPFH_like 107..314 CDD:302763 135/204 (66%)
StomNP_038543.1 PHB 53..204 CDD:214581 94/150 (63%)
SPFH_stomatin 73..274 CDD:259801 134/200 (67%)
Required for homooligomerization. /evidence=ECO:0000250 265..273 6/7 (86%)
Required for lipid raft association. /evidence=ECO:0000250 267..269 1/1 (100%)
Interaction with LANCL1. /evidence=ECO:0000250 273..284 1/4 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 69 1.000 Domainoid score I9581
eggNOG 1 0.900 - - E1_COG0330
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG54926
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100539
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
98.690

Return to query results.
Submit another query.