DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Mec2 and nphs2

DIOPT Version :9

Sequence 1:NP_573357.1 Gene:Mec2 / 32905 FlyBaseID:FBgn0030993 Length:350 Species:Drosophila melanogaster
Sequence 2:XP_017949096.1 Gene:nphs2 / 100498000 XenbaseID:XB-GENE-485101 Length:376 Species:Xenopus tropicalis


Alignment Length:295 Identity:131/295 - (44%)
Similarity:188/295 - (63%) Gaps:16/295 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 TTQQYRGFKTSENEPKG--CMEWVVTLFSVLIFIITSPIAIFICFKVVAEYERAIIFRLGR-LSG 108
            |:|:..|.|     |.|  ..|.::....:|:.|:|.|::|:.|.|||.|||||:|||||| |||
 Frog    80 TSQKDDGVK-----PAGFRVFEGLLIFCCLLLVILTLPLSIWFCVKVVREYERAVIFRLGRMLSG 139

  Fly   109 GARGPGMFFILPCIDEYRKVDLRTVTFNVPQQEMLTKDSVTVTVDAVVYYRISDPLYAVIQVEDY 173
            .|||||:||.|||:|:..|||.|..||.||..:::|||.||:.:|.:.|||:.:....:..|...
 Frog   140 RARGPGLFFYLPCLDKCHKVDFRLKTFEVPFHQIVTKDLVTLEIDVICYYRLENACLFLTSVSSI 204

  Fly   174 SMSTRLLAATTLRNIVGTRNLSELLTERETLAHNMQATLDEATEPWGVMVERVEIKDVSLPVSMQ 238
            |.:.:||..||.:.::..|...::|.||:::...::..||.||..||:.|||.|||||.||..::
 Frog   205 SSAFQLLVQTTTKRLLAHRAFLDILLERKSIGEEVKVALDAATCHWGIKVERTEIKDVKLPEEVK 269

  Fly   239 RAMAAEAEAARDARAKVIAAEGEKKSATALKEASDVISASPSALQLRYLQTLSSISAEKNSTIIF 303
            ::||.||||.|.|:.|||||||||..:..:|.|::.:|.||:|:|||||.||..:::||.:|.:.
 Frog   270 QSMAVEAEAQRHAKVKVIAAEGEKTVSEYIKLAAEKLSGSPTAIQLRYLHTLQCMTSEKPATFVL 334

  Fly   304 PLPMELLTPYLAKYAHLMGPPPELKQSPE--KSDN 336
            |||.:|:.  |...|.|    ||:..:|.  ||||
 Frog   335 PLPFDLMN--LNAVARL----PEINPTPNTPKSDN 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Mec2NP_573357.1 PHB 88..238 CDD:214581 72/150 (48%)
SPFH_like 107..314 CDD:302763 93/206 (45%)
nphs2XP_017949096.1 SPFH_podocin 116..338 CDD:259809 107/221 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1062075at2759
OrthoFinder 1 1.000 - - FOG0000760
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.