DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7556 and ERJ5

DIOPT Version :9

Sequence 1:NP_001285427.1 Gene:CG7556 / 32902 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_116699.3 Gene:ERJ5 / 850602 SGDID:S000001937 Length:295 Species:Saccharomyces cerevisiae


Alignment Length:286 Identity:71/286 - (24%)
Similarity:125/286 - (43%) Gaps:66/286 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 RPELTLAGLLLLCATGASAWHSEELEIFDLVEEV------NRNFYEFMGIN--QTATGAEVKRAF 60
            :|.|.:.||:.|    :.|:.:.|.|||.|..|:      :.|||:|:.:.  |.::..|:.:..
Yeast     6 KPALVVLGLVSL----SYAFTTIETEIFQLQNEISTKYGPDMNFYKFLKLPKLQNSSTKEITKNL 66

  Fly    61 RTLSIVLHPDKNPAEDANIQFRNLVSIYEVLKDPSRREKYDRVLKEGMPNW--KSALYYYRRMRK 123
            |.||...||||||......:..||.:  ::|.:.|.|:.||..|:.|.||:  ....:|:.||:.
Yeast    67 RKLSKKYHPDKNPKYRKLYERLNLAT--QILSNSSNRKIYDYYLQNGFPNYDFHKGGFYFSRMKP 129

  Fly   124 IGLYEGAFILFLITTVGQYLFAWAAYLEKKYTAEQVF----------GTKLKKLQKKNKNID--- 175
            ...:..||| :::..:|||:.:...|..::...|...          |..:|:|..|....|   
Yeast   130 KTWFLLAFI-WIVVNIGQYIISIIQYRSQRSRIENFISQCKQQDDTNGLGVKQLTFKQHEKDEGK 193

  Fly   176 ------MDVILSE------------IPMPSLLNTLPIQIPLALWNL------------------P 204
                  .||.:.|            :..||:.|.|..:||.::||:                  .
Yeast   194 SLVVRFSDVYVVEPDGSETLISPDTLDKPSVKNCLFWRIPASVWNMTFGKSVGSAGKEEIITDSK 258

  Fly   205 RTIKNGFSKANELKELALEKRRQELE 230
            :...|...|.|::|:.:.:|.::::|
Yeast   259 KYDGNQTKKGNKVKKGSAKKGQKKME 284

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 20/62 (32%)
SANT 301..>341 CDD:197842
SANT 304..341 CDD:238096
SANT 399..447 CDD:197842
SANT 400..447 CDD:238096
ERJ5NP_116699.3 CbpA 41..271 CDD:225124 56/232 (24%)
DnaJ 44..105 CDD:395170 20/62 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005801
OrthoInspector 1 1.000 - - oto99203
orthoMCL 1 0.900 - - OOG6_105968
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1934
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
65.740

Return to query results.
Submit another query.