DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7556 and RL5

DIOPT Version :10

Sequence 1:NP_573354.1 Gene:CG7556 / 32902 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_564087.2 Gene:RL5 / 838537 AraportID:AT1G19510 Length:100 Species:Arabidopsis thaliana


Alignment Length:83 Identity:24/83 - (28%)
Similarity:35/83 - (42%) Gaps:18/83 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   393 SMLIPETNWTQEQQRALEAAIVKYRKTAGGDRWQKIANSVPEKTKEECLVRYKYLCELVKTQKRA 457
            |.:...::||.:|.:..|.|:..|.|.. .||||.:|.:|..|:.||....|..|.         
plant     4 SSMSSSSSWTSKQNKMFERALAVYDKDT-PDRWQNVAKAVGSKSAEEVKRHYDILV--------- 58

  Fly   458 EEEANEPDEDAAAIEEEL 475
                    ||...||::|
plant    59 --------EDLMNIEQDL 68

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7556NP_573354.1 DnaJ 40..101 CDD:395170
SANT 304..341 CDD:238096
SANT 400..447 CDD:238096 17/46 (37%)
RL5NP_564087.2 SANT 18..54 CDD:238096 13/36 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.