DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7556 and maMYB

DIOPT Version :9

Sequence 1:NP_001285427.1 Gene:CG7556 / 32902 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001331471.1 Gene:maMYB / 834578 AraportID:AT5G45420 Length:309 Species:Arabidopsis thaliana


Alignment Length:339 Identity:77/339 - (22%)
Similarity:138/339 - (40%) Gaps:60/339 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   144 FAWAAYLEKKYTAEQVFGTKLKKLQKKNKNIDMDVILSEI--------PMPSLLNTLPIQI---P 197
            |.:.:.....:|||:....::......:.::.:.:|:..:        |..|||..|.:..   |
plant    11 FVFQSRPSSSHTAEEEEEARIPNKLFISISVSISLIILSLSFFYFESEPAKSLLLWLSLSFLVGP 75

  Fly   198 LALWNLPRTIKNGFSKANELKELALEKRR----QELEAVRRQEELEREAEEQARLRKEHKENLRK 258
            .|    |.::..|             |.|    |.||..:..:|...:.|.::|     ::::.|
plant    76 FA----PSSLTGG-------------KIRVGYGQILEPEQIHDESSTDNERESR-----RKSVNK 118

  Fly   259 RKQNSKAPEKTEEELRGYSQIQTRELTDDDAVRPASQKSTVSGGF-----WTDEDLTELIRLVKK 318
            |.:.|...:...|.....:::..:      .|.|.|::   ||..     ||.|::..|.:.:.|
plant   119 RSKGSTKSDNPPENASAVTEVSRK------VVIPQSKE---SGSVNETKDWTAEEIEILKKQLIK 174

  Fly   319 YPGGAGSRWNTIAESMNRSVQEVTFMAAKMKENGYRIPGQTDSVAEALVQESQQAQRKEKVKKAA 383
            :|.|...||.|:|.:.....:... :..|.||.|.:...::|..|:.|........|.....:..
plant   175 HPAGKPGRWETVASAFGGRYKTEN-VIKKAKEIGEKKIYESDDYAQFLKNRKASDPRLVDENEEN 238

  Fly   384 ANAGASAEKSMLIPETNWTQEQQRALEAAIVKYRKTAGGDRWQKIANSVPEKTKEECLVRYKYLC 448
            :.||..||.:..|    |:..:..||..|:..:.|.| ..||:|||.:||.|:|..|:   |.:.
plant   239 SGAGGDAEGTKEI----WSNGEDIALLNALKAFPKEA-AMRWEKIAAAVPGKSKAACM---KRVT 295

  Fly   449 ELVKTQKRAEEEAN 462
            ||.|..:.::..||
plant   296 ELKKGFRSSKTPAN 309

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647
SANT 301..>341 CDD:197842 12/44 (27%)
SANT 304..341 CDD:238096 11/36 (31%)
SANT 399..447 CDD:197842 17/47 (36%)
SANT 400..447 CDD:238096 17/46 (37%)
maMYBNP_001331471.1 SANT 160..>193 CDD:238096 11/32 (34%)
SANT 252..298 CDD:238096 18/49 (37%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.