DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7556 and RL3

DIOPT Version :10

Sequence 1:NP_573354.1 Gene:CG7556 / 32902 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_195375.4 Gene:RL3 / 829809 AraportID:AT4G36570 Length:58 Species:Arabidopsis thaliana


Alignment Length:64 Identity:19/64 - (29%)
Similarity:33/64 - (51%) Gaps:11/64 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   383 AANAGASAEKSMLIPETNWTQEQQRALEAAIVKYRKTAGGDRWQKIANSVPEKTKEECLVRYKY 446
            |:|:.:|:        .:||:::.:..|.|:..|.:.. .|||..:|.:|..|:.||  ||..|
plant     2 ASNSMSSS--------ASWTRKENKLFERALATYDQDT-PDRWHNVARAVGGKSAEE--VRRHY 54

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7556NP_573354.1 DnaJ 40..101 CDD:395170
SANT 304..341 CDD:238096
SANT 400..447 CDD:238096 16/47 (34%)
RL3NP_195375.4 SANT 12..54 CDD:238096 15/44 (34%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.