DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7556 and AT3G10595

DIOPT Version :10

Sequence 1:NP_573354.1 Gene:CG7556 / 32902 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_683547.2 Gene:AT3G10595 / 820228 AraportID:AT3G10595 Length:183 Species:Arabidopsis thaliana


Alignment Length:126 Identity:29/126 - (23%)
Similarity:53/126 - (42%) Gaps:24/126 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   304 WTDEDLTELIRLVKKYPGGAGSRWNTIAESMNRSVQEVTFMAAKMKENGYRIPGQTDSVAEALVQ 368
            ||.|:.......:..:.....:|:.::||.::|||.:|       ||: |:     :.|.:.|..
plant     6 WTTEENEMFKDALVMFTAFLLTRFESVAEYVDRSVDDV-------KEH-YK-----ELVNDLLEM 57

  Fly   369 ESQQAQRKEKVKKAAANAGASAEKSMLIPETNWTQEQQRALEAAIVKYRKTAGGDRWQKIA 429
            .|.:.....::.|..|.:...||:      |.||:|........:.::     |..|:|||
plant    58 GSSRVAFPNELTKDMAQSSYQAER------TIWTKETHEWFLIGLDRF-----GKDWRKIA 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7556NP_573354.1 DnaJ 40..101 CDD:395170
SANT 304..341 CDD:238096 9/36 (25%)
SANT 400..447 CDD:238096 8/30 (27%)
AT3G10595NP_683547.2 Myb_DNA-binding 84..118 CDD:459731 8/29 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.