DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7556 and CG10565

DIOPT Version :9

Sequence 1:NP_001285427.1 Gene:CG7556 / 32902 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001246856.1 Gene:CG10565 / 40332 FlyBaseID:FBgn0037051 Length:646 Species:Drosophila melanogaster


Alignment Length:598 Identity:133/598 - (22%)
Similarity:227/598 - (37%) Gaps:177/598 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 EELEI-----FDLVEEVNRNFYEFMGINQ---TATGAEVKRAFRTLSIVLHPDKNPAEDANI--- 79
            ||::|     .|..|..:::.|..:|:.:   .|:..:|:||:|.:.::.||||..|:...:   
  Fly    57 EEVDISYLKSLDPKEWKDQDHYAVLGLGKLRYEASEDDVRRAYRRMVLLHHPDKRKAKGEEVIQD 121

  Fly    80 --QFRNLVSIYEVLKDPSRREKYDRV---LKEGMPNWKSALYYYRRMRKIGLYEGAFILF----- 134
              .|..:...||:|.....|..:|.|   ..:.:|:.......|     .|::...|.|.     
  Fly   122 DDYFTCITKAYEILGTSKPRRSFDSVDPEFDDSLPSQNDIDNDY-----FGVFNKFFTLNGRWSE 181

  Fly   135 --LITTVGQ-----------YLF-----AWA--AYLEKKYTAEQVFGTKLKKLQKKN-------K 172
              .:.:.||           |.|     :|.  :||:::...:.....:.:.::|:|       |
  Fly   182 KPHVPSFGQVDAKREEVERFYNFWYDFKSWREFSYLDEEDKEKGQDRDERRWIEKENRAARIKRK 246

  Fly   173 NIDMDVILSEIPMPSLLNTLPIQ------------IPLALWNLPRTIKNGFSKANELKELALEKR 225
            ..:|..|.|.:.: :..|...||            ...|..:..:..|....:|  ::|.||.|.
  Fly   247 KEEMSRIRSLVDL-AYNNDKRIQRFKQEEKDRKAAAKRAKMDAAQAQKAEADRA--IREAALAKE 308

  Fly   226 RQELEAVRRQEELEREAEEQARLRKEHKENLRKRKQNSK-------------------------- 264
            :.|....:|.|::..|.|:|.:|.|:.::.||.:.::.|                          
  Fly   309 KAEKAEQKRIEQIRIEREQQKKLLKKERKTLRDKVKDCKYYAKNDKDQLKHMEGTEKICETFNLA 373

  Fly   265 -----------------------APEKTEEELRGYSQIQTRELTDDDAVRPASQKSTVSGGFWTD 306
                                   |.:|...||...:|.|.::|. ..|..|...|.......|::
  Fly   374 ELQALNKAMESKGRESFVAALQTAEQKIAAELEEINQTQAKKLA-SSAATPKGVKEVKKNELWSN 437

  Fly   307 EDLTELIRLVKKYPGGAGSRWNTIAESMNRSVQEVTFMA--------AKMKEN----GYRIPGQT 359
            |::..||:.|..:|.|...||:.||..:|:...:.|.:.        ||..:|    ...:..|.
  Fly   438 ENVQLLIKAVNLFPAGTAQRWDVIATFINQHSPDNTVLVNARDVLNKAKALQNTDHSKSSLKTQA 502

  Fly   360 DSVAEA----------------LVQESQQAQRKEKVKK-----------------AAANAGASAE 391
            :..|.|                |.:|:.||. ||.:|:                 |.|.|..:|.
  Fly   503 NDAAFASFEKSKKDVQTCKDITLGEETAQAS-KENLKQNGVDHKANNQSTKQNGTAPAPANPTAA 566

  Fly   392 KSMLIPETN-----------WTQEQQRALEAAIVKYRKTAGGDRWQKIANSVPEKTKEECLVRYK 445
            .:. :|.||           ||:|:|..||.||..| .|...|||..||..:|.::|::||.|.|
  Fly   567 PAP-VPATNGSTGGGAASKTWTKEEQALLEQAIKTY-PTTTPDRWDCIAACIPNRSKKDCLRRVK 629

  Fly   446 YLCELVKTQKRAE 458
            .|.|||.::|.|:
  Fly   630 ELVELVNSKKEAQ 642

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 17/68 (25%)
SANT 301..>341 CDD:197842 12/39 (31%)
SANT 304..341 CDD:238096 12/36 (33%)
SANT 399..447 CDD:197842 23/58 (40%)
SANT 400..447 CDD:238096 22/57 (39%)
CG10565NP_001246856.1 CbpA 76..282 CDD:225124 40/211 (19%)
DnaJ 76..145 CDD:278647 17/68 (25%)
RILP-like 268..>344 CDD:304877 18/77 (23%)
RAC_head 332..401 CDD:293322 5/68 (7%)
SANT 584..633 CDD:197842 22/49 (45%)
SANT 585..632 CDD:238096 21/47 (45%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464384
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0724
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.