DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7556 and CG8531

DIOPT Version :9

Sequence 1:NP_001285427.1 Gene:CG7556 / 32902 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_610945.1 Gene:CG8531 / 36584 FlyBaseID:FBgn0033918 Length:545 Species:Drosophila melanogaster


Alignment Length:157 Identity:42/157 - (26%)
Similarity:68/157 - (43%) Gaps:31/157 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 EVNRNFYEFMGINQTATGAEVKRAFRTLSIVLHPDKNPAED----ANIQFRNLVSIYEVLKDPSR 96
            |::.|:|.|:.:.:.||..::..|:|..|.:.||||:...|    |.|.|......||||.||.:
  Fly    11 ELDENYYTFLNLPRDATAEQINTAYRKQSRMFHPDKHLDPDSKKMAEIMFNRTKRAYEVLSDPQQ 75

  Fly    97 REKYDRVLKEGMPNWKSALYYYRRMRKIGLYEGAFILFLITTVGQYLFAWAAYLEKKY--TAEQV 159
            |..||.|.::|:..                 ||..||....|..:        :.::|  .|:..
  Fly    76 RAIYDSVGEKGLRT-----------------EGWEILHRTKTPDE--------IREEYERLAQAA 115

  Fly   160 FGTKLKKLQKKNKNIDMDVILSEIPMP 186
            ...:|::......||.::|..:||..|
  Fly   116 AERRLQQRTNPRGNITINVNATEIFAP 142

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 23/64 (36%)
SANT 301..>341 CDD:197842
SANT 304..341 CDD:238096
SANT 399..447 CDD:197842
SANT 400..447 CDD:238096
CG8531NP_610945.1 DnaJ 15..>91 CDD:223560 27/92 (29%)
DnaJ 15..80 CDD:278647 23/64 (36%)
DUF3395 409..538 CDD:288708
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45464380
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.930

Return to query results.
Submit another query.