DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7556 and Tpr2

DIOPT Version :9

Sequence 1:	NP_001285427.1	Gene:	CG7556 / 32902	FlyBaseID:	FBgn0030990	Length:	522	Species:	Drosophila melanogaster
Sequence 2:	NP_001260501.1	Gene:	Tpr2 / 34984	FlyBaseID:	FBgn0032586	Length:	508	Species:	Drosophila melanogaster

Alignment Length:	77	Identity:	21/77 - (27%)
Similarity:	44/77 - (57%)	Gaps:	6/77 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly    31 FDLVEEVNRNFYEFMGINQTATGAEVKRAFRTLSIVLHPDKNPAEDA------NIQFRNLVSIYE 89
            |.|.:...:::|:.:||.:.|:..|:|:|:|..::|.|||::....|      .::|:.:...|.
  Fly   393 FALKKSKRKDYYKILGIGRNASDDEIKKAYRKKALVHHPDRHANSSAEERKEEELKFKEVGEAYA 457

  Fly    90 VLKDPSRREKYD 101
            :|.|..::.:||
  Fly   458 ILSDAHKKSRYD 469

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7556	NP_001285427.1	DnaJ	40..101	CDD:278647	17/66 (26%)
		SANT	301..>341	CDD:197842
		SANT	304..341	CDD:238096
		SANT	399..447	CDD:197842
		SANT	400..447	CDD:238096
Tpr2	NP_001260501.1	TPR_11	49..114	CDD:290150
		TPR repeat	49..77	CDD:276809
		TPR repeat	82..112	CDD:276809
		TPR_11	201..262	CDD:290150
		TPR repeat	201..225	CDD:276809
		TPR_1	231..264	CDD:278916
		TPR repeat	231..259	CDD:276809
		TPR_11	278..345	CDD:290150
		TPR repeat	310..344	CDD:276809
		TPR_11	314..380	CDD:290150
		TPR repeat	349..377	CDD:276809
		DnaJ	401..>503	CDD:223560	19/69 (28%)
		DnaJ	402..469	CDD:278647	17/66 (26%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C45464383
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
	1	0.930