DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7556 and Atac1

DIOPT Version :9

Sequence 1:NP_001285427.1 Gene:CG7556 / 32902 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_609088.1 Gene:Atac1 / 33977 FlyBaseID:FBgn0031876 Length:356 Species:Drosophila melanogaster


Alignment Length:300 Identity:62/300 - (20%)
Similarity:118/300 - (39%) Gaps:64/300 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly   215 NELKELALEKRRQELEAVRRQEELEREAEEQARLRKEHKENLRKRKQNSKAPEKTEEELRGYSQI 279
            |.|:.||:    .:.:.:|..:::| |.|....:..|:.:::..:.:|:       |.|...:.|
  Fly    31 NLLRTLAV----LQAQRIRVHQQIE-ELEATQNIYLENPQHMLDKLRNN-------EPLIADNYI 83

  Fly   280 QTRELTDDDAVRP--------------------ASQKSTVSGG-------FWTDEDLTELIRLVK 317
            .|..|.|...:.|                    |::....|.|       .||:|:.:.|.:|:.
  Fly    84 TTTVLPDLPTLSPNDEEGGTNETPTDASSWTQEANKNRDRSNGRSENFNRLWTNEEQSRLEQLLI 148

  Fly   318 KYPGGAGS--RWNTIAESM-NRSVQEVTFMA----AKMKENGYRIPGQTDSVAEALVQESQQAQR 375
            :||.....  |:..||::: ||:.|:|....    .|:.:.|..:||:       :.:..:....
  Fly   149 QYPPEEVEMRRFGKIAKALGNRTAQQVYSRVQKYFQKLHDAGMPVPGR-------IPKHRRPGLS 206

  Fly   376 KEKVKKAAANAGASAEKSMLIPETNWTQEQQRALEAA-------IVKYRKTAGGDRWQKIANSVP 433
            |.|:|...:....:...|:.:||.::|.:..|....|       ..|.......:......|:..
  Fly   207 KPKIKLRKSTFFPAHNISLQMPEDDFTFDDLRIPSPASDMLLMPASKIEPKIESEYMDADLNAES 271

  Fly   434 EKTKEECLVRYKYLCELVKTQKRAEEEANEPDEDAAAIEE 473
            ::.:|.||    .|...::.:||..|:..|||..||...|
  Fly   272 KRKQELCL----KLLSAIQDEKREMEDGYEPDLLAAKCAE 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647
SANT 301..>341 CDD:197842 14/49 (29%)
SANT 304..341 CDD:238096 13/39 (33%)
SANT 399..447 CDD:197842 8/54 (15%)
SANT 400..447 CDD:238096 8/53 (15%)
Atac1NP_609088.1 SANT 135..185 CDD:197842 14/49 (29%)
SANT 135..183 CDD:238096 14/47 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0724
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.