DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7556 and DNAJB5

DIOPT Version :10

Sequence 1:NP_573354.1 Gene:CG7556 / 32902 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_001128477.1 Gene:DNAJB5 / 25822 HGNCID:14887 Length:420 Species:Homo sapiens


Alignment Length:75 Identity:26/75 - (34%)
Similarity:47/75 - (62%) Gaps:0/75 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    34 VEEVNRNFYEFMGINQTATGAEVKRAFRTLSIVLHPDKNPAEDANIQFRNLVSIYEVLKDPSRRE 98
            |..:.:::|:.:||...|...|:|:|:|.:::..|||||...:|..:|:.:...|:||.||.:|.
Human    70 VAVMGKDYYKILGIPSGANEDEIKKAYRKMALKYHPDKNKEPNAEEKFKEIAEAYDVLSDPKKRG 134

  Fly    99 KYDRVLKEGM 108
            .||:..:||:
Human   135 LYDQYGEEGL 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7556NP_573354.1 DnaJ 40..101 CDD:395170 21/60 (35%)
SANT 304..341 CDD:238096
SANT 400..447 CDD:238096
DNAJB5NP_001128477.1 DnaJ_bact 76..415 CDD:274090 25/69 (36%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.