DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7556 and SPAC2E1P5.03

DIOPT Version :9

Sequence 1:NP_001285427.1 Gene:CG7556 / 32902 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_594141.1 Gene:SPAC2E1P5.03 / 2541520 PomBaseID:SPAC2E1P5.03 Length:303 Species:Schizosaccharomyces pombe


Alignment Length:305 Identity:70/305 - (22%)
Similarity:117/305 - (38%) Gaps:72/305 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LLLLCATGASAWHSEELEIFDLVEEV------NRNFYEFMGINQTATGAEVKRAFRTLSIVLHPD 70
            :|||......||.|.:||||.:|:.:      ...|||.:.:...|:..|:.||:|..||:.|||
pombe     6 ILLLLFGVCLAWTSSDLEIFRVVDSLKSILKNKATFYELLEVPTKASIKEINRAYRKKSILYHPD 70

  Fly    71 KNPAEDANIQFRNLVSIYEVLKDPSRREKYDRVLKEGMPNWKSALYYYRRMRKIGLYEGAFILFL 135
            |||..........|  |..:|::...|::||..||.|.|.||...|.|.|.|. ||.....:|||
pombe    71 KNPKSKELYTLLGL--IVNILRNTETRKRYDYFLKNGFPRWKGTGYLYSRYRP-GLGAVLVLLFL 132

  Fly   136 ITTVGQYL-------------------------FAWAAYLEKK----------YTAEQVFGTKLK 165
            :.::..::                         :|.:|...|:          ||.:.:.|... 
pombe   133 LISIAHFVMLVISSKRQKKIMQDHIDIARQHESYATSARGSKRIVQVPGGRRIYTVDSITGQVC- 196

  Fly   166 KLQKKNKNIDMDVILSEIPMPSLLNTLPIQIP-LALWNLPRTIKNGFSKANELKELALEKRRQEL 229
             :...:.||:..|....:....:.:|...::| ..:||   .....|::|....|          
pombe   197 -ILDPSSNIEYLVSPDSVASVKISDTFFYRLPRFIVWN---AFGRWFARAPASSE---------- 247

  Fly   230 EAVRRQEELEREAEEQARLRKEHKENLRKRKQNSKAPEKTEEELR 274
                       :.:...::..|.|.: ...|.:..:|.|.|..::
pombe   248 -----------DTDSDGQMEDEEKSD-SVHKSSFSSPSKKEASIK 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647 20/60 (33%)
SANT 301..>341 CDD:197842
SANT 304..341 CDD:238096
SANT 399..447 CDD:197842
SANT 400..447 CDD:238096
SPAC2E1P5.03NP_594141.1 CbpA 34..261 CDD:225124 54/255 (21%)
DnaJ 40..99 CDD:278647 20/60 (33%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0724
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005801
OrthoInspector 1 1.000 - - oto100752
orthoMCL 1 0.900 - - OOG6_105968
Panther 1 1.100 - - LDO PTHR44653
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1934
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
76.840

Return to query results.
Submit another query.