DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7556 and C47A4.1

DIOPT Version :9

Sequence 1:NP_001285427.1 Gene:CG7556 / 32902 FlyBaseID:FBgn0030990 Length:522 Species:Drosophila melanogaster
Sequence 2:NP_502648.2 Gene:C47A4.1 / 183525 WormBaseID:WBGene00008122 Length:157 Species:Caenorhabditis elegans


Alignment Length:138 Identity:28/138 - (20%)
Similarity:50/138 - (36%) Gaps:49/138 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly   169 KKNKNIDMDVILSEI-----------PMPSLLNTL---PIQIPL---------ALWNLPRTIKNG 210
            ||||.:|.|.::.:|           ...|:.:||   .|..||         |||.....|:. 
 Worm     8 KKNKGVDNDEVIKQIIIDNLDVTGGYKRESIYDTLAWHTIIFPLTIFRYIKWTALWYWRFAIQK- 71

  Fly   211 FSKANELKELALEKR-----RQELEAVRRQEEL-------------------EREAEEQARLRKE 251
             .:.::..:|.|.::     :.|.:.....|::                   ||:|.||.::.:.
 Worm    72 -EEYDDDAKLYLIRKYIGVSQMEFDQKYTDEDIDDLFERECWLKTNCATWKAERDAAEQEKMAQS 135

  Fly   252 HKENLRKR 259
            .:....||
 Worm   136 GRYKRYKR 143

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7556NP_001285427.1 DnaJ 40..101 CDD:278647
SANT 301..>341 CDD:197842
SANT 304..341 CDD:238096
SANT 399..447 CDD:197842
SANT 400..447 CDD:238096
C47A4.1NP_502648.2 None
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160164687
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.840

Return to query results.
Submit another query.