DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7556 and dnj-7

DIOPT Version :9

Sequence 1:	NP_001285427.1	Gene:	CG7556 / 32902	FlyBaseID:	FBgn0030990	Length:	522	Species:	Drosophila melanogaster
Sequence 2:	NP_509209.1	Gene:	dnj-7 / 180983	WormBaseID:	WBGene00001025	Length:	491	Species:	Caenorhabditis elegans

Alignment Length:	95	Identity:	25/95 - (26%)
Similarity:	50/95 - (52%)	Gaps:	9/95 - (9%)

- Green bases have known domain annotations that are detailed below.

  Fly    17 ATGASAWHSEELEIFDLVEEV-----NRNFYEFMGINQTATGAEVKRAFRTLSIVLHPDKNPAED 76
            ||..:..|.|..|..:..:.:     .|::|:.:|:.:.|:..|:.:|:|.|:...|||....|:
Worm   351 ATEVNPDHREAKEGLEHAKRLKTQAGKRDYYKILGVKRNASKREITKAYRKLAQKWHPDNFSDEE 415

  Fly    77 ----ANIQFRNLVSIYEVLKDPSRREKYDR 102
                |..:|.::.:..|||:|..:|.::|:
Worm   416 EKKKAEKKFIDIAAAKEVLQDEEKRRQFDQ 445

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7556	NP_001285427.1	DnaJ	40..101	CDD:278647	18/64 (28%)
		SANT	301..>341	CDD:197842
		SANT	304..341	CDD:238096
		SANT	399..447	CDD:197842
		SANT	400..447	CDD:238096
dnj-7	NP_509209.1	TPR_11	29..91	CDD:290150
		TPR repeat	29..54	CDD:276809
		TPR repeat	59..89	CDD:276809
		TPR_1	60..93	CDD:278916
		TPR_11	61..124	CDD:290150
		TPR	77..360	CDD:223533	3/8 (38%)
		TPR repeat	94..121	CDD:276809
		TPR repeat	140..168	CDD:276809
		TPR repeat	173..203	CDD:276809
		TPR repeat	208..236	CDD:276809
		TPR repeat	324..354	CDD:276809	2/2 (100%)
		TPR_1	325..358	CDD:278916	2/6 (33%)
		DnaJ	377..>445	CDD:223560	19/67 (28%)
		DnaJ	379..444	CDD:278647	18/64 (28%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	1	0.930	-	-		C160164689
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
	1	0.930