DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx5 and inx-5

DIOPT Version :9

Sequence 1:NP_573353.2 Gene:Inx5 / 32901 FlyBaseID:FBgn0030989 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_509403.2 Gene:inx-5 / 181086 WormBaseID:WBGene00002127 Length:447 Species:Caenorhabditis elegans


Alignment Length:373 Identity:82/373 - (21%)
Similarity:150/373 - (40%) Gaps:129/373 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 TVVILLTCSLLLSARQYFGDPIQC-------ISEEKNIEYIQSYCWTMGTYILKLDDFGDQEQAL 88
            |..:|...:::::|.||.|.||||       .:.||   |.::||:..|||.|......:.|.::
 Worm    30 TSTLLGFSAIMMAASQYVGRPIQCWVPAQFTRTWEK---YAETYCFIKGTYFLPGAFASEGEMSV 91

  Fly    89 VSPNQEVSYNSAFFSSATTNAPQSSSRVRTRPHFRSSLRRIGEYNEAYARSLSIAEGVGPEIRGQ 153
            .||:           .|.|..||                                  ||      
 Worm    92 TSPD-----------DAVTATPQ----------------------------------VG------ 105

  Fly   154 TERQYLRYYQWVIILLLFQSFVFYFPSCLWKVWEGR---RLKQLCSEVGDALLSEETYNTRLRM- 214
                   ||||:.|:|:.|:|:||.||.:|:.:...   ::|:|      |.:||.:...:..| 
 Worm   106 -------YYQWIPIVLVLQAFLFYLPSIIWRTFNESCELKIKEL------AAVSEASRKIKSNMS 157

  Fly   215 --------LVKYFTTDYEDMHF-----------CYMAKYVFCEVLNFLISVVNI--IVLEVFLNG 258
                    ..:||   ::.::|           ..:|...|...|..|:.::.:  |||:.::..
 Worm   158 DDQVKATKFGRYF---FKKLNFRNESPVFKETGSVVASGKFLPALYLLVKILYLANIVLQFWILT 219

  Fly   259 F----------WSKYLRALATIPFYDWDRWNRVSSSVFPKIAKCEVLKFGGSGTANVMDN--LCI 311
            :          |..:...:|.   .:|:     ::.:||::..|:   |......:|.|:  .|:
 Worm   220 YFLETKSWMWGWQTFQDLMAG---REWE-----TTGIFPRVTMCD---FSIMDLTSVHDHSIQCV 273

  Fly   312 LPLNILNEKIFVFLWAWFLLMALMSGLNLLCRLAMICSRYLREQMIRS 359
            :.:|:|.||::||.|.|.|.:.|::    :|.||.....|:.:.:.|:
 Worm   274 IVINMLAEKVYVFFWFWLLFVGLLT----VCSLAYWAVIYMLQSVGRN 317

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Inx5NP_573353.2 Innexin 21..405 CDD:279248 82/373 (22%)
inx-5NP_509403.2 Innexin 20..379 CDD:279248 82/373 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 133 1.000 Domainoid score I3133
eggNOG 1 0.900 - - E1_2BWHM
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 134 1.000 Inparanoid score I3152
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - mtm4755
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X282
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.