DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Inx5 and inx-14

DIOPT Version :9

Sequence 1:NP_573353.2 Gene:Inx5 / 32901 FlyBaseID:FBgn0030989 Length:419 Species:Drosophila melanogaster
Sequence 2:NP_492078.1 Gene:inx-14 / 172488 WormBaseID:WBGene00002136 Length:434 Species:Caenorhabditis elegans


Alignment Length:419 Identity:89/419 - (21%)
Similarity:152/419 - (36%) Gaps:130/419 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 FKSIRIYDSVFTIHSRCTVVILLTCSLLLSARQYFGDPIQCISEEKN------IEYIQSYCWTMG 72
            ||:.::|:....:| ..||.:|....||..|:|:||:||.|:..:::      .:||.::|...|
 Worm    16 FKAAKLYEFYDRLH-LFTVYLLGFFVLLTGAKQHFGNPIDCMLPKQHDDLKSWRDYIHNFCLFYG 79

  Fly    73 TYILKLDDFGDQEQALVSPNQEVSYNSAFFSSATTNAPQSSSRVRTRPHFRSSLRRIGEYNEAYA 137
            |:                 ..:||..::.|.|.|.:|.                           
 Worm    80 TF-----------------RYDVSNGTSEFGSYTEDAS--------------------------- 100

  Fly   138 RSLSIAEGVGPEIRGQTERQYLRYYQWVIILLLFQSFVFYFPSCLWKVWEGRRL----KQLCSEV 198
                                 :.|||||.....||...|..|...|...:  :|    .....:.
 Worm   101 ---------------------VNYYQWVPFFFAFQVCCFLLPFWCWAYMQ--KLIYIDMAFIVDY 142

  Fly   199 GDALLSEETY---NTRLRMLVKYFTTDYEDMHFCYMAKYVFCEVLNF-------------LISVV 247
            ...:.||:|:   ..::..:|.|.   ::...|....|..:...:.|             |..:.
 Worm   143 SGKINSEKTFEKTKEKVDRIVNYM---HDHFKFRRAHKMGYLSWITFNSAFPSVLYSLTKLFFIT 204

  Fly   248 NIIV----------LEVFLNGF--WSKYLRALATIP----FYDWDR---------WNRVSSSVFP 287
            |:|:          ::.:..||  ..|::......|    |.|..|         :||.  ..||
 Worm   205 NVIIQVNLVCKFLDVDSWTWGFDLLGKFIHPTPRAPEFSSFSDKQRFAAILTDGSYNRF--QYFP 267

  Fly   288 KIAKCEV-LKFGGSGTANVMDNLCILPLNILNEKIFVFLWAWFLLMALMSGLNLLCRLAMICSRY 351
            .:..||. |:...|...|.... ||:|:|::|||||:.|:.|.|::..:|.:..:..:..|.|:.
 Worm   268 ILVGCEYQLQESVSNFVNHKAQ-CIIPMNVINEKIFIGLYFWLLVLTALSVIGTVKWILRIKSKK 331

  Fly   352 LREQMIRSQLRFMTKRHVKRALRDLTIGD 380
            |.|.||..    :.|:.::|...|..|.|
 Worm   332 LNEVMIYK----LIKKSLEREPFDSNIHD 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Inx5NP_573353.2 Innexin 21..405 CDD:279248 86/412 (21%)
inx-14NP_492078.1 Innexin 24..397 CDD:279248 86/411 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D323554at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR11893
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.020

Return to query results.
Submit another query.