DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP18B and Chn2

DIOPT Version :9

Sequence 1:NP_573352.2 Gene:RhoGAP18B / 32898 FlyBaseID:FBgn0261461 Length:1317 Species:Drosophila melanogaster
Sequence 2:NP_114473.2 Gene:Chn2 / 84031 RGDID:620140 Length:468 Species:Rattus norvegicus


Alignment Length:203 Identity:56/203 - (27%)
Similarity:96/203 - (47%) Gaps:24/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1122 LFAAPLSAL-ELNMTDHPNVPRFVVDVCAYIEQPECIEQDGLYRASGNKVLVDELRKKLTHVYDP 1185
            ::...|:.| :.:.|..|    .|||:|....:...::.:||||.||....:::::.    .:|.
  Rat   274 VYCCDLTTLVKAHNTQRP----MVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKM----AFDR 330

  Fly  1186 RWLKTD-------DIHTLTSLHKQFFRELTSPLITQEAYERL---GRSLNDDAAIERMSLAFDDM 1240
            ...|.|       ||:.:|...|.:||:|..|:||.:.|.:.   .:..|.|..:|.:......:
  Rat   331 DGEKADISANIYPDINIITGALKLYFRDLPIPIITYDTYSKFIEAAKISNADERLEAVHEVLMLL 395

  Fly  1241 PEPNRSTLRFLIRHLTRVAAASASNRMPSTNLAIVWGPCLL-----SANQIQLDIGRMNMLAKVL 1300
            |..:..|||:|:.||.:|......|.|.:.||.||:||.|:     |......|:....::.::|
  Rat   396 PPAHYETLRYLMIHLKKVTMNEKDNLMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQIL 460

  Fly  1301 IENYDRIF 1308
            |||.|.:|
  Rat   461 IENEDVLF 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP18BNP_573352.2 RhoGAP 1141..1289 CDD:279014 45/162 (28%)
Chn2NP_114473.2 SH2_a2chimerin_b2chimerin 52..138 CDD:198215
C1_betaCHN 210..270 CDD:410407
RhoGAP_chimaerin 275..468 CDD:239837 55/200 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.