DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP18B and AT5G19390

DIOPT Version :9

Sequence 1:NP_573352.2 Gene:RhoGAP18B / 32898 FlyBaseID:FBgn0261461 Length:1317 Species:Drosophila melanogaster
Sequence 2:NP_197440.2 Gene:AT5G19390 / 832059 AraportID:AT5G19390 Length:870 Species:Arabidopsis thaliana


Alignment Length:239 Identity:59/239 - (24%)
Similarity:100/239 - (41%) Gaps:41/239 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly  1107 RGQVNSLYLDEQKYPLFAAPLS-ALELNMTDHPNVPRFVVDVCAYIEQPECIEQDGLYRASGNKV 1170
            |.:.|......:|.||.:..:. .:.|.:.|....|.|:.....:||: ...:.:|:.|.|.:  
plant   141 RAETNEAIEGREKRPLKSLVVGRPILLALEDIDGSPSFLEKALQFIEK-YGTKIEGILRQSAD-- 202

  Fly  1171 LVDELRKKLTHVYDPRWLKT--DDIHTLTSLHKQFFRELTSPLITQ-------EAYERLGRSLND 1226
             |:|:.:::......:...|  :|.|.:....|...|||.|..::.       |||    |..:.
plant   203 -VEEVERRVQEYEQGKTEFTFDEDPHVVGDCIKHVLRELPSSPVSASCCTALLEAY----RIESK 262

  Fly  1227 DAAIERMSLAF-DDMPEPNRSTLRFLIRHLTRVAAASASNRMPSTNLAIVWGPCLLS---ANQIQ 1287
            :|.|..:..|. :..|||||..|:.:::.:..:::.|..|||....:|....|.||.   |.:..
plant   263 EARISSLRSAIAETFPEPNRRLLQRILKMMHTISSHSHENRMNPNAVAACMAPLLLRPLLAGECD 327

  Fly  1288 L----DIGRMN---MLA------------KVLIENYDRIFHPDN 1312
            |    |.|..|   :||            .||:|:|..||..:|
plant   328 LEDDFDGGEDNSAQLLAAANAANNAQAIITVLLEDYGSIFDEEN 371

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP18BNP_573352.2 RhoGAP 1141..1289 CDD:279014 40/164 (24%)
AT5G19390NP_197440.2 PH 19..125 CDD:278594
PH 19..125 CDD:214574
RhoGAP 176..313 CDD:279014 35/144 (24%)
Lzipper-MIP1 610..689 CDD:291087
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
00.000

Return to query results.
Submit another query.