DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP18B and arhgap32

DIOPT Version :9

Sequence 1:NP_573352.2 Gene:RhoGAP18B / 32898 FlyBaseID:FBgn0261461 Length:1317 Species:Drosophila melanogaster
Sequence 2:XP_004916221.2 Gene:arhgap32 / 734056 XenbaseID:XB-GENE-1002474 Length:1995 Species:Xenopus tropicalis


Alignment Length:253 Identity:68/253 - (26%)
Similarity:118/253 - (46%) Gaps:39/253 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1078 NRMRMKFAVNSNVFRINRSPKSEKKSRSRRGQVNSLYLDEQKYPLFAAPLSALELNMTDHPNVPR 1142
            :|...|.......|..:|..|.:.|.|.        .|.|:   :|...|....||  ...:||:
 Frog   382 SRKHGKLITFLRTFMKSRPSKQKLKQRG--------ILRER---VFGCDLGEHLLN--SGQDVPQ 433

  Fly  1143 FVVDVCAYIEQPECIEQDGLYRASGNKVLVDELRKKLTHVYDPRWLK-------TDDIHTLTSLH 1200
            .:.....:||:...:  ||:||.||    :....:||.|.:|...:.       ..|||.:.||.
 Frog   434 VLRSCTEFIEKHGIV--DGIYRLSG----IASNIQKLRHEFDSEQIPDLTKDVYIQDIHCVGSLC 492

  Fly  1201 KQFFRELTSPLITQEAYERLGRSLN---DDAAIERMSLAFDDMPEPNRSTLRFLIRHLTRVAAAS 1262
            |.:||||.:||:|.:.||:...:::   |:..:.::......:|.|:..||.||:|||:|:|...
 Frog   493 KLYFRELPNPLLTYQLYEKFSDAVSAATDEERLVKIHDVIQQLPPPHYRTLEFLMRHLSRLATYC 557

  Fly  1263 ASNRMPSTNLAIVWGPCLLSANQIQ----------LDIGRMNMLAKVLIENYDRIFHP 1310
            :...|.:.||||||.|.||.:.||:          :::...:::.:.::.:.:.:|.|
 Frog   558 SITNMHTKNLAIVWAPNLLRSKQIESACFSGTAAFMEVRIQSVVVEFILNHVEVLFSP 615

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP18BNP_573352.2 RhoGAP 1141..1289 CDD:279014 52/167 (31%)
arhgap32XP_004916221.2 PX_RICS 131..245 CDD:132831
SH3_ARHGAP32_33 267..320 CDD:212769
RhoGAP_CdGAP 414..608 CDD:239849 57/204 (28%)
ZipA <1758..>1898 CDD:225657
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.