Sequence 1: | NP_573352.2 | Gene: | RhoGAP18B / 32898 | FlyBaseID: | FBgn0261461 | Length: | 1317 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | XP_699642.6 | Gene: | chn2 / 570999 | ZFINID: | ZDB-GENE-091020-5 | Length: | 466 | Species: | Danio rerio |
Alignment Length: | 203 | Identity: | 57/203 - (28%) |
---|---|---|---|
Similarity: | 97/203 - (47%) | Gaps: | 24/203 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 1122 LFAAPLSALELNMTDHPNVPR-FVVDVCAYIEQPECIEQDGLYRASGNKVLVDELRKKLTHVYDP 1185
Fly 1186 RWLKTD-------DIHTLTSLHKQFFRELTSPLITQEAYERL---GRSLNDDAAIERMSLAFDDM 1240
Fly 1241 PEPNRSTLRFLIRHLTRVAAASASNRMPSTNLAIVWGPCLLSANQIQL-----DIGRMNMLAKVL 1300
Fly 1301 IENYDRIF 1308 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
RhoGAP18B | NP_573352.2 | RhoGAP | 1141..1289 | CDD:279014 | 46/163 (28%) |
chn2 | XP_699642.6 | SH2_a2chimerin_b2chimerin | 52..138 | CDD:198215 | |
C1_1 | 213..265 | CDD:278556 | |||
RhoGAP_chimaerin | 273..466 | CDD:239837 | 56/200 (28%) | ||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 1 | 1.000 | - | - | ||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
ZFIN | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.910 |