DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP18B and chn2

DIOPT Version :9

Sequence 1:NP_573352.2 Gene:RhoGAP18B / 32898 FlyBaseID:FBgn0261461 Length:1317 Species:Drosophila melanogaster
Sequence 2:XP_699642.6 Gene:chn2 / 570999 ZFINID:ZDB-GENE-091020-5 Length:466 Species:Danio rerio


Alignment Length:203 Identity:57/203 - (28%)
Similarity:97/203 - (47%) Gaps:24/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1122 LFAAPLSALELNMTDHPNVPR-FVVDVCAYIEQPECIEQDGLYRASGNKVLVDELRKKLTHVYDP 1185
            :|:..|:.|   :..| |.|| .|:|:|....:...::.:||||.||....::::|..    :|.
Zfish   272 VFSCDLTTL---VKAH-NTPRPMVLDMCIREIEHRGLKSEGLYRVSGFTEHIEDVRLS----FDR 328

  Fly  1186 RWLKTD-------DIHTLTSLHKQFFRELTSPLITQEAYERL---GRSLNDDAAIERMSLAFDDM 1240
            ...|.|       ||:.:....|.:.|:|..|:||.:.|.|.   .:..:.|:.:|.:......:
Zfish   329 DGEKADISANIYPDINIIAGALKLYLRDLPIPVITYDVYSRFIQAAKITDPDSRLEAVHDGLLQL 393

  Fly  1241 PEPNRSTLRFLIRHLTRVAAASASNRMPSTNLAIVWGPCLLSANQIQL-----DIGRMNMLAKVL 1300
            |..:..|||:|:.||.||......|.|.|.||.||:||.|:....:..     |:....::.::|
Zfish   394 PPAHYETLRYLMTHLKRVTMYEKDNYMNSENLGIVFGPTLMRPPDLNTLTTLNDMRYQKLIVQLL 458

  Fly  1301 IENYDRIF 1308
            ||:.|.:|
Zfish   459 IEHEDILF 466

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP18BNP_573352.2 RhoGAP 1141..1289 CDD:279014 46/163 (28%)
chn2XP_699642.6 SH2_a2chimerin_b2chimerin 52..138 CDD:198215
C1_1 213..265 CDD:278556
RhoGAP_chimaerin 273..466 CDD:239837 56/200 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.