DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP18B and arhgap32b

DIOPT Version :9

Sequence 1:NP_573352.2 Gene:RhoGAP18B / 32898 FlyBaseID:FBgn0261461 Length:1317 Species:Drosophila melanogaster
Sequence 2:XP_009293685.1 Gene:arhgap32b / 569434 ZFINID:ZDB-GENE-091204-147 Length:1956 Species:Danio rerio


Alignment Length:246 Identity:69/246 - (28%)
Similarity:118/246 - (47%) Gaps:39/246 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly  1091 FRINRSPKSEKKSRSRRGQVNSLYLDEQKYPLFAAPLSALELNMTDHPNVPRFVVDVCAYIEQPE 1155
            |..:|..|.:.|.|.        .|.|:   :|...|....|| :.| :||:.:.....:||:..
Zfish   388 FMKSRPTKQKLKQRG--------ILRER---VFGCDLGEHLLN-SGH-DVPQVLKSCTEFIEKHG 439

  Fly  1156 CIEQDGLYRASGNKVLVDELRKKLTHVYDPRWLK-------TDDIHTLTSLHKQFFRELTSPLIT 1213
            .:  ||:||.||    :....:||.|.:|...:.       ..|||.:.||.|.:||||.:||:|
Zfish   440 VV--DGMYRLSG----IASNIQKLRHEFDSEQIPDLTKDVYIQDIHCVGSLCKLYFRELPNPLLT 498

  Fly  1214 QEAYERLGRSLN---DDAAIERMSLAFDDMPEPNRSTLRFLIRHLTRVAAASASNRMPSTNLAIV 1275
            .:.||:...:::   |:..:.::......:|.|:..||.||:|||:.:|..|....|.:.|||||
Zfish   499 YQLYEKFSEAVSAATDEERLIKIHDVIQQLPPPHYRTLEFLMRHLSHLATFSYVTNMHTKNLAIV 563

  Fly  1276 WGPCLLSANQIQ----------LDIGRMNMLAKVLIENYDRIFHPDNERLV 1316
            |.|.||.:.||:          :::...:::.:.::.:.|.:|.|....|:
Zfish   564 WAPNLLRSKQIESACFSGTAAFMEVRIQSVVVEFILNHVDVLFSPKLSSLI 614

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP18BNP_573352.2 RhoGAP 1141..1289 CDD:279014 52/167 (31%)
arhgap32bXP_009293685.1 PX_domain 124..238 CDD:295365
SH3_ARHGAP32_33 260..313 CDD:212769
RhoGAP_CdGAP 407..601 CDD:239849 58/204 (28%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.