DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP18B and Arhgap9

DIOPT Version :9

Sequence 1:NP_573352.2 Gene:RhoGAP18B / 32898 FlyBaseID:FBgn0261461 Length:1317 Species:Drosophila melanogaster
Sequence 2:XP_006241526.1 Gene:Arhgap9 / 362893 RGDID:1305342 Length:642 Species:Rattus norvegicus


Alignment Length:415 Identity:105/415 - (25%)
Similarity:169/415 - (40%) Gaps:94/415 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   952 HQHNPTPAIPKPLKEEWERAVLAAGAVAGKRGVAPRTGRKLRVRSNAR----------LLLTD-- 1004
            ::..|....|   .:.|..|.....:....||.|..:||:|..|.|..          ||.:|  
  Rat   263 YRERPPQCAP---SQGWAPAGSRPESSVDLRGAALASGRQLSSRRNVLHIRTVPGHEFLLQSDEE 324

  Fly  1005 -SVLAWRETLQDV---NCCEDEEDMIVPVTDILR------AQQIQ----EDNEVQQTQQSTILQR 1055
             .:.||...|:.|   ....|.|:.:.     ||      |:..:    ||:|::....|..|.|
  Rat   325 TELRAWHRALRAVIERLVRRDRENPLE-----LRLSGSGPAELAELSGGEDDELESEPVSKSLMR 384

  Fly  1056 YKSVSIGNLLDLPGEDDKKSIKNRMRMKFAVNSNVFRINRSPKSEKKSRSRRGQVNSLYLDEQKY 1120
            ..|....:.. ..|.|.|..::|:::...|....:           :|...||    |:.|:   
  Rat   385 LGSRRTSSRC-AEGTDQKNRVRNKLKRLIAKRPTL-----------QSLQERG----LFRDQ--- 430

  Fly  1121 PLFAAPLSALELNMTDHPNVPRFVVDVCAYIEQPECIEQDGLYRASGNKVLVDELR----KKLTH 1181
             :|...|.:|.....|  .||.| |.:|......:.::.||:||.|||..:|.:||    ::...
  Rat   431 -VFGCQLESLCQREGD--TVPSF-VRLCVEAVDKKGLDVDGIYRVSGNLAVVQKLRFLVDRERAV 491

  Fly  1182 VYDPRWL----------------KTDDIHTLTSLHKQFFRELTSPLIT-------QEAYERLGRS 1223
            ..|.|::                :.||||.:|...|.|||||..||:.       ::|.|     
  Rat   492 TSDGRYMFPEQPGQEGKLDLDSAEWDDIHVITGALKLFFRELPQPLVPALLLPHFRDALE----- 551

  Fly  1224 LND-DAAIERMSLAFDDMPEPNRSTLRFLIRHLTRVAAASASNRMPSTNLAIVWGPCLLSANQIQ 1287
            |:: :..:.::....|.:|.||..||::::.||.||.|.|..|||.:.||.||:||.|....|..
  Rat   552 LSEPEHCLSKIQKLIDSLPRPNHDTLQYILEHLCRVIAHSDKNRMTAHNLGIVFGPTLFRPEQEA 616

  Fly  1288 LDIGR----MNMLAKVLIENYDRIF 1308
            .|:..    ...|.::::.|:..:|
  Rat   617 SDMAAHVVYPGQLIQLMLNNFASLF 641

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP18BNP_573352.2 RhoGAP 1141..1289 CDD:279014 55/175 (31%)
Arhgap9XP_006241526.1 SH3 27..82 CDD:302595
PH_ARHGAP9-like 227..340 CDD:270053 19/79 (24%)
PH 241..339 CDD:278594 19/78 (24%)
RhoGAP_ARHGAP27_15_12_9 432..636 CDD:239868 62/211 (29%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000816
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR23176
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.100

Return to query results.
Submit another query.