DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP18B and racgap1

DIOPT Version :9

Sequence 1:NP_573352.2 Gene:RhoGAP18B / 32898 FlyBaseID:FBgn0261461 Length:1317 Species:Drosophila melanogaster
Sequence 2:NP_955925.1 Gene:racgap1 / 323197 ZFINID:ZDB-GENE-030131-1917 Length:654 Species:Danio rerio


Alignment Length:152 Identity:61/152 - (40%)
Similarity:84/152 - (55%) Gaps:14/152 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1138 PNVPRFVVDVCAYIEQPECIEQDGLYRASGNKVLVDELRKK-LTHVYDPRWLKTDDIHTLTSLHK 1201
            |.:|..||.....||| ..:.:.||||.||:..:|.:|::| |.....|...|.:|||.:|.|.|
Zfish   383 PMIPSLVVHCINEIEQ-RGLHETGLYRVSGSDRVVKDLKEKFLRGKTVPLLSKVEDIHAITGLLK 446

  Fly  1202 QFFRELTSPLITQEAYERLGRSL-------NDDAAIERMSLAFDDMPEPNRSTLRFLIRHLTRVA 1259
            .|.|.|..||:|    .||.|:.       :||.:|..|.....|:|:|:|.||.|||.||.|||
Zfish   447 DFLRNLKEPLLT----FRLNRAFMDAAELSDDDNSIALMYQNISDLPQPHRDTLAFLIIHLQRVA 507

  Fly  1260 AASASNRMPSTNLAIVWGPCLL 1281
            .:.|: :|..||||.|:||.::
Zfish   508 QSPAT-KMDITNLARVFGPTIV 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP18BNP_573352.2 RhoGAP 1141..1289 CDD:279014 60/149 (40%)
racgap1NP_955925.1 C1 310..358 CDD:237996
RhoGAP_MgcRacGAP 369..562 CDD:239847 61/152 (40%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.