DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP18B and Racgap1

DIOPT Version :9

Sequence 1:NP_573352.2 Gene:RhoGAP18B / 32898 FlyBaseID:FBgn0261461 Length:1317 Species:Drosophila melanogaster
Sequence 2:NP_001101582.1 Gene:Racgap1 / 315298 RGDID:1305912 Length:626 Species:Rattus norvegicus


Alignment Length:217 Identity:67/217 - (30%)
Similarity:101/217 - (46%) Gaps:22/217 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1121 PLFAAPLSALELNMTD-----HPNVPRFVVDVCAYIEQPECIEQDGLYRASGNKVLVDELRKKLT 1180
            ||...|:...|..:.|     .|.:|..||.....||| ..:.:.||||.||....|.||::|..
  Rat   337 PLVGTPVKIGEGMLADFVSQTSPMIPAIVVSCVNEIEQ-RGLTEAGLYRISGCDRTVKELKEKFL 400

  Fly  1181 HVYD-PRWLKTDDIHTLTSLHKQFFRELTSPLIT---QEAYERLGRSLNDDAAIERMSLAFDDMP 1241
            .|.. |...|.||||.:.||.|.|.|.|..||:|   .:|:.......::|.:...|..|..::|
  Rat   401 KVKTVPLLSKVDDIHAICSLLKDFLRNLKEPLLTFWLSKAFMEAAEITDEDNSTAAMYQAVSELP 465

  Fly  1242 EPNRSTLRFLIRHLTRVAAASASNRMPSTNLAIVWGPCLLS-----------ANQIQLDIGRMNM 1295
            :.||.||.||:.||.|| |.|.|.:|...|||.::||.:::           ...|:..:..:..
  Rat   466 QANRDTLAFLMIHLQRV-AQSPSTKMDVVNLAKIFGPTIVAHTVPNPDPVTMFQDIKRQLKVVER 529

  Fly  1296 LAKVLIENYDRIFHPDNERLVC 1317
            |..:.:|.:::....:.|.:.|
  Rat   530 LLSLPLEYWNQFMMVEQENMDC 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP18BNP_573352.2 RhoGAP 1141..1289 CDD:279014 57/162 (35%)
Racgap1NP_001101582.1 C1 286..334 CDD:237996
RhoGAP_MgcRacGAP 345..538 CDD:239847 62/194 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.