DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP18B and RACGAP1

DIOPT Version :10

Sequence 1:NP_573352.2 Gene:RhoGAP18B / 32898 FlyBaseID:FBgn0261461 Length:1317 Species:Drosophila melanogaster
Sequence 2:XP_024304726.1 Gene:RACGAP1 / 29127 HGNCID:9804 Length:651 Species:Homo sapiens


Alignment Length:170 Identity:62/170 - (36%)
Similarity:84/170 - (49%) Gaps:11/170 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly  1122 LFAAPLSALELNMTD-----HPNVPRFVVDVCAYIEQPECIEQDGLYRASGNKVLVDELRKKLTH 1181
            |...|:...|..:.|     .|.:|..||.....||| ..:.:.||||.||....|.||::|...
Human   358 LIGTPVKIGEGMLADFVSQTSPMIPSIVVHCVNEIEQ-RGLTETGLYRISGCDRTVKELKEKFLR 421

  Fly  1182 VYD-PRWLKTDDIHTLTSLHKQFFRELTSPLIT---QEAYERLGRSLNDDAAIERMSLAFDDMPE 1242
            |.. |...|.||||.:.||.|.|.|.|..||:|   ..|:.......::|.:|..|..|..::|:
Human   422 VKTVPLLSKVDDIHAICSLLKDFLRNLKEPLLTFRLNRAFMEAAEITDEDNSIAAMYQAVGELPQ 486

  Fly  1243 PNRSTLRFLIRHLTRVAAASASNRMPSTNLAIVWGPCLLS 1282
            .||.||.||:.||.|| |.|...:|...|||.|:||.:::
Human   487 ANRDTLAFLMIHLQRV-AQSPHTKMDVANLAKVFGPTIVA 525

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP18BNP_573352.2 RhoGAP 1141..1285 CDD:459875 57/146 (39%)
RACGAP1XP_024304726.1 SMC_prok_B 32..>124 CDD:274008
C1_MgcRacGAP 304..357 CDD:410371
RhoGAP_MgcRacGAP 365..558 CDD:239847 60/163 (37%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.