DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP18B and Racgap1

DIOPT Version :9

Sequence 1:NP_573352.2 Gene:RhoGAP18B / 32898 FlyBaseID:FBgn0261461 Length:1317 Species:Drosophila melanogaster
Sequence 2:NP_001240737.1 Gene:Racgap1 / 26934 MGIID:1349423 Length:628 Species:Mus musculus


Alignment Length:215 Identity:66/215 - (30%)
Similarity:99/215 - (46%) Gaps:22/215 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1121 PLFAAPLSALELNMTD-----HPNVPRFVVDVCAYIEQPECIEQDGLYRASGNKVLVDELRKKLT 1180
            ||...|:...|..:.|     .|.:|..||.....||| ..:.:.||||.||....|.||::|..
Mouse   339 PLVGTPVKIGEGMLADFVSQASPMIPAIVVSCVNEIEQ-RGLTEAGLYRISGCDRTVKELKEKFL 402

  Fly  1181 HVYD-PRWLKTDDIHTLTSLHKQFFRELTSPLIT---QEAYERLGRSLNDDAAIERMSLAFDDMP 1241
            .|.. |...|.||||.:.||.|.|.|.|..||:|   .:|:.......::|.:...|..|..::|
Mouse   403 KVKTVPLLSKVDDIHVICSLLKDFLRNLKEPLLTFWLSKAFMEAAEITDEDNSTAAMYQAVSELP 467

  Fly  1242 EPNRSTLRFLIRHLTRVAAASASNRMPSTNLAIVWGPCLLS-----------ANQIQLDIGRMNM 1295
            :.||.||.||:.||.|| :.|...:|...|||.|:||.:::           ...|:..:..:..
Mouse   468 QANRDTLAFLMIHLQRV-SQSPDTKMDIANLAKVFGPTIVAHTVPNPDPVTMFQDIKRQLKVVER 531

  Fly  1296 LAKVLIENYDRIFHPDNERL 1315
            |..:.:|.:::....|.|.:
Mouse   532 LLSLPLEYWNQFMMVDQENI 551

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP18BNP_573352.2 RhoGAP 1141..1289 CDD:279014 56/162 (35%)
Racgap1NP_001240737.1 Tropomyosin 43..>108 CDD:395200
Interaction with SLC26A8. /evidence=ECO:0000250 107..286
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 179..201
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 242..284
C1_MgcRacGAP 286..339 CDD:410371 66/215 (31%)
RhoGAP_MgcRacGAP 347..540 CDD:239847 61/194 (31%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3564
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.