DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP18B and srgp-1

DIOPT Version :9

Sequence 1:NP_573352.2 Gene:RhoGAP18B / 32898 FlyBaseID:FBgn0261461 Length:1317 Species:Drosophila melanogaster
Sequence 2:NP_001255566.1 Gene:srgp-1 / 178079 WormBaseID:WBGene00006406 Length:1059 Species:Caenorhabditis elegans


Alignment Length:265 Identity:63/265 - (23%)
Similarity:107/265 - (40%) Gaps:27/265 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1057 KSVSIGNLLDLPGEDDKKSIKNRMRMKFAVNSNVFRINRSPKSEKKSRSRR-GQVNSLYLDEQKY 1120
            ||.|:|:..:..|.              ....|....|.....|::|::|| |.:.:...|::..
 Worm   471 KSASVGSASERNGS--------------FTTENGGSQNHHLLEERRSKARRIGGIVTKSPDDRPR 521

  Fly  1121 P-LFAAPLSALELNMTDHPNVPRFVVDVCAYIEQPECIEQDGLYRASGNKVLVDELRKKLTHVYD 1184
            | ||...|.  |........:|..|....||:.: ..:...||:|.||::..::..|:......|
 Worm   522 PKLFGGSLD--EYVEATGEEIPLLVQSAIAYLSR-YSLRNQGLFRVSGSQSEINRFREAYERGED 583

  Fly  1185 PRWLKTD--DIHTLTSLHKQFFRELTSPLITQEAYERL---GRSLNDDAAIERMSLAFDDMPEPN 1244
            ......|  |.::...:.|.:||||..|:.....:|:.   .:|.:....:.|.......:|..:
 Worm   584 LFQYLDDGSDANSAAGVLKLYFRELREPIFPIFMFEQFCDCAKSESPTEFVRRARELVSKLPVSH 648

  Fly  1245 RSTLRFLIRHLTRVAAASASNRMPSTNLAIVWGPCLLSANQIQLDI---GRMNMLAKVLIENYDR 1306
            ...||||...|:.:...:..|.|...||||.:||.||...:.:..:   ..:|.|.:.||.:.|.
 Worm   649 VLLLRFLFAFLSHLCEFADENMMEPHNLAICFGPTLLPIPEGKDQVFYHNYVNELVRNLIIHADD 713

  Fly  1307 IFHPD 1311
            :|..|
 Worm   714 VFPRD 718

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP18BNP_573352.2 RhoGAP 1141..1289 CDD:279014 38/152 (25%)
srgp-1NP_001255566.1 F-BAR_srGAP 60..300 CDD:153340
RhoGAP 523..710 CDD:383032 46/189 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 86 1.000 Inparanoid score I3724
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.960

Return to query results.
Submit another query.