DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP18B and chin-1

DIOPT Version :9

Sequence 1:NP_573352.2 Gene:RhoGAP18B / 32898 FlyBaseID:FBgn0261461 Length:1317 Species:Drosophila melanogaster
Sequence 2:NP_497323.3 Gene:chin-1 / 175268 WormBaseID:WBGene00015267 Length:421 Species:Caenorhabditis elegans


Alignment Length:152 Identity:40/152 - (26%)
Similarity:75/152 - (49%) Gaps:12/152 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1144 VVDVCAYIEQPECIEQDGLYRASGNKVLVDELRKKLTHVYDPRWLKTDDIHTLTSLHKQFFRELT 1208
            :|.:|....:...::.:|:||.||:...:::|:::.............||||:..|.|.:||.|.
 Worm   250 IVPLCIGEVESRGLDVEGIYRVSGSYDHMEKLKQQFDSNQYVDLATVCDIHTVCGLLKLYFRLLP 314

  Fly  1209 SPLITQEAYERL--------GRSLND-DAAIERMSLAFDDMPEPNRSTLRFLIRHLTRVAAASAS 1264
            ..||....:::|        .||.:: :..|.::.:   ::.:.|..||..::.||.:||..||.
 Worm   315 QQLIPFSVHKQLLVAYQETNQRSTHERERQIRKVMM---ELSDANIITLGAVLAHLKKVADHSAK 376

  Fly  1265 NRMPSTNLAIVWGPCLLSANQI 1286
            |:|...|||.::.|.|..:..|
 Worm   377 NKMTVENLATIFSPTLFCSGSI 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP18BNP_573352.2 RhoGAP 1141..1289 CDD:279014 40/152 (26%)
chin-1NP_497323.3 SH2_a2chimerin_b2chimerin 43..130 CDD:198215
C1_1 172..224 CDD:278556
RhoGAP 248..413 CDD:238090 40/152 (26%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.