DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP18B and chin-1

DIOPT Version :10

Sequence 1:NP_573352.2 Gene:RhoGAP18B / 32898 FlyBaseID:FBgn0261461 Length:1317 Species:Drosophila melanogaster
Sequence 2:NP_497323.3 Gene:chin-1 / 175268 WormBaseID:WBGene00015267 Length:421 Species:Caenorhabditis elegans


Alignment Length:152 Identity:40/152 - (26%)
Similarity:75/152 - (49%) Gaps:12/152 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly  1144 VVDVCAYIEQPECIEQDGLYRASGNKVLVDELRKKLTHVYDPRWLKTDDIHTLTSLHKQFFRELT 1208
            :|.:|....:...::.:|:||.||:...:::|:::.............||||:..|.|.:||.|.
 Worm   250 IVPLCIGEVESRGLDVEGIYRVSGSYDHMEKLKQQFDSNQYVDLATVCDIHTVCGLLKLYFRLLP 314

  Fly  1209 SPLITQEAYERL--------GRSLND-DAAIERMSLAFDDMPEPNRSTLRFLIRHLTRVAAASAS 1264
            ..||....:::|        .||.:: :..|.::.:   ::.:.|..||..::.||.:||..||.
 Worm   315 QQLIPFSVHKQLLVAYQETNQRSTHERERQIRKVMM---ELSDANIITLGAVLAHLKKVADHSAK 376

  Fly  1265 NRMPSTNLAIVWGPCLLSANQI 1286
            |:|...|||.::.|.|..:..|
 Worm   377 NKMTVENLATIFSPTLFCSGSI 398

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP18BNP_573352.2 RhoGAP 1141..1285 CDD:459875 39/149 (26%)
chin-1NP_497323.3 SH2_a2chimerin_b2chimerin 43..130 CDD:198215
C1_CHN 171..223 CDD:410356
RhoGAP 248..413 CDD:238090 40/152 (26%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.