DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP18B and RacGAP84C

DIOPT Version :9

Sequence 1:NP_573352.2 Gene:RhoGAP18B / 32898 FlyBaseID:FBgn0261461 Length:1317 Species:Drosophila melanogaster
Sequence 2:NP_476704.1 Gene:RacGAP84C / 117503 FlyBaseID:FBgn0045843 Length:384 Species:Drosophila melanogaster


Alignment Length:173 Identity:55/173 - (31%)
Similarity:82/173 - (47%) Gaps:16/173 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly  1138 PNVPRFVVDVCAYIEQPECIEQDGLYRASGNKVLVDELRKKLTHVYDPRWLKTDDIHTLTSLHKQ 1202
            |.||..:|.....|| ...::|:||||.|..:.....||:||........|...|.|||....|.
  Fly   158 PMVPALIVHCVTEIE-ARGLQQEGLYRVSSTREKCKRLRRKLLRGKSTPHLGNKDTHTLCCCVKD 221

  Fly  1203 FFRELTSPLIT---QEAYERLGRSLNDDAAIE-RMSLAFDDMPEPNRSTLRFLIRHLTRVAAASA 1263
            |.|:|..|||.   :..:|...|. .|..|:| .:.||..::.:.:|.||.:|:.|..::|.:.|
  Fly   222 FLRQLVHPLIPIYHRRDFEEATRH-EDRLAVEMAVYLAVLELHQAHRDTLAYLMLHWQKIAESPA 285

  Fly  1264 SNRMPSTNLAIVWGPCLLSANQIQLDIGRMNMLA-----KVLI 1301
            . ||...|||:::.|.|..    .||:...|::.     |||:
  Fly   286 V-RMTVNNLAVIFAPTLFG----DLDLTLENVVTWQRVLKVLL 323

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP18BNP_573352.2 RhoGAP 1141..1289 CDD:279014 47/151 (31%)
RacGAP84CNP_476704.1 C1_1 87..139 CDD:278556
RhoGAP_MgcRacGAP 142..330 CDD:239847 55/173 (32%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG3564
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.