DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP18B and CHN2

DIOPT Version :10

Sequence 1:NP_573352.2 Gene:RhoGAP18B / 32898 FlyBaseID:FBgn0261461 Length:1317 Species:Drosophila melanogaster
Sequence 2:XP_047275795.1 Gene:CHN2 / 1124 HGNCID:1944 Length:514 Species:Homo sapiens


Alignment Length:203 Identity:56/203 - (27%)
Similarity:96/203 - (47%) Gaps:24/203 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly  1122 LFAAPLSAL-ELNMTDHPNVPRFVVDVCAYIEQPECIEQDGLYRASGNKVLVDELRKKLTHVYDP 1185
            ::...|:.| :.:.|..|    .|||:|....:...::.:||||.||....:::::.    .:|.
Human   320 VYCCDLTTLVKAHNTQRP----MVVDICIREIEARGLKSEGLYRVSGFTEHIEDVKM----AFDR 376

  Fly  1186 RWLKTD-------DIHTLTSLHKQFFRELTSPLITQEAYERL---GRSLNDDAAIERMSLAFDDM 1240
            ...|.|       ||:.:|...|.:||:|..|:||.:.|.:.   .:..|.|..:|.:......:
Human   377 DGEKADISANVYPDINIITGALKLYFRDLPIPVITYDTYSKFIDAAKISNADERLEAVHEVLMLL 441

  Fly  1241 PEPNRSTLRFLIRHLTRVAAASASNRMPSTNLAIVWGPCLL-----SANQIQLDIGRMNMLAKVL 1300
            |..:..|||:|:.||.:|......|.|.:.||.||:||.|:     |......|:....::.::|
Human   442 PPAHYETLRYLMIHLKKVTMNEKDNFMNAENLGIVFGPTLMRPPEDSTLTTLHDMRYQKLIVQIL 506

  Fly  1301 IENYDRIF 1308
            |||.|.:|
Human   507 IENEDVLF 514

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP18BNP_573352.2 RhoGAP 1141..1285 CDD:459875 45/158 (28%)
CHN2XP_047275795.1 SH2_a2chimerin_b2chimerin 98..184 CDD:198215
C1_betaCHN 256..316 CDD:410407
RhoGAP_chimaerin 321..514 CDD:239837 55/200 (28%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.