DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RhoGAP18B and chn2

DIOPT Version :9

Sequence 1:NP_573352.2 Gene:RhoGAP18B / 32898 FlyBaseID:FBgn0261461 Length:1317 Species:Drosophila melanogaster
Sequence 2:XP_002933428.2 Gene:chn2 / 100496459 XenbaseID:XB-GENE-950874 Length:467 Species:Xenopus tropicalis


Alignment Length:186 Identity:57/186 - (30%)
Similarity:91/186 - (48%) Gaps:20/186 - (10%)


- Green bases have known domain annotations that are detailed below.


  Fly  1139 NVPR-FVVDVCAYIEQPECIEQDGLYRASGNKVLVDELRKKLTHVYDPRWLKT---DDIHTLTSL 1199
            |.|| .|||:|....:...::.:||||.||....:::::.......|...:.:   .||:.:|..
 Frog   286 NTPRPMVVDMCIQEIEGRGLKSEGLYRVSGFTEHIEDVKMSFDRDGDRADISSTLYPDINIITGA 350

  Fly  1200 HKQFFRELTSPLITQEAYERL---GRSLNDDAAIERMSLAFDDMPEPNRSTLRFLIRHLTRVAAA 1261
            .|.:||:|..|:||.:.|.:.   .:..|.|..:|.:..|...:|..:..|||||:.||.:||..
 Frog   351 LKLYFRDLPIPVITYDTYYKFMEASKISNADERLEAIHEALMLLPPAHYETLRFLMIHLKKVALN 415

  Fly  1262 SASNRMPSTNLAIVWGPCLL---------SANQIQLDIGRMNMLAKVLIENYDRIF 1308
            ...|.|.|.||.||:||.|:         |.|    |:.....:.::||:|.|.:|
 Frog   416 EKDNLMGSENLGIVFGPTLMRPPEENALASLN----DMRHQKQIVQLLIQNEDVLF 467

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RhoGAP18BNP_573352.2 RhoGAP 1141..1289 CDD:279014 50/163 (31%)
chn2XP_002933428.2 SH2_a2chimerin_b2chimerin 52..138 CDD:198215
C1_betaCHN 209..269 CDD:410407
RhoGAP_chimaerin 274..467 CDD:239837 56/184 (30%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.