DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tgy and LFNG

DIOPT Version :10

Sequence 1:NP_573349.4 Gene:tgy / 32896 FlyBaseID:FBgn0030984 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_001035257.1 Gene:LFNG / 3955 HGNCID:6560 Length:379 Species:Homo sapiens


Alignment Length:269 Identity:59/269 - (21%)
Similarity:99/269 - (36%) Gaps:71/269 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 LAEKM-HREVRVLCWVLTTPKYHKTRAIHVLRTWGKRCNKIYFMTSEPDDE-----LPTVVLTKP 147
            |||.: .|:|.:.  |.||.|:|:.|...:|.||..|..::.|:.::.:||     ...||:|..
Human   106 LAEPLAPRDVFIA--VKTTKKFHRARLDLLLETWISRHKEMTFIFTDGEDEALARHTGNVVITNC 168

  Fly   148 DRYEMLWGKTKEAFVHIHEQMRHEADWFIKADDDTYLFLENLRYMLYPYSPETPIYFG---FNYK 209
            .........:.:..|.....:.....||...|||.|:.|..|..:|..|.....:|.|   .:..
Human   169 SAAHSRQALSCKMAVEYDRFIESGRKWFCHVDDDNYVNLRALLRLLASYPHTRDVYVGKPSLDRP 233

  Fly   210 MVGTHQKNES--------YMSGGSGYVLSRE-ALRI--FAEG---VNDTTKCRQEDD-------- 252
            :....:.:|:        :.:||:|:.:||. ||::  :|.|   :|...:.|..||        
Human   234 IQAMERVSENKVRPVHFWFATGGAGFCISRGLALKMSPWASGGHFMNTAERIRLPDDCTIGYIVE 298

  Fly   253 -------------HA--------------EDVEMGKCLFN-----------LGVKAGDSRDEQLR 279
                         |:              |.|.:...:|.           ..|:|..||...:.
Human   299 ALLGVPLIRSGLFHSHLENLQQVPTSELHEQVTLSYGMFENKRNAVHVKGPFSVEADPSRFRSIH 363

  Fly   280 NRFYPIAPY 288
            ...||..|:
Human   364 CHLYPDTPW 372

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 592.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
tgyNP_573349.4 Galactosyl_T 103..>270 CDD:473923 48/234 (21%)