DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tgy and lfng

DIOPT Version :10

Sequence 1:NP_573349.4 Gene:tgy / 32896 FlyBaseID:FBgn0030984 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_571046.2 Gene:lfng / 30158 ZFINID:ZDB-GENE-980605-16 Length:374 Species:Danio rerio


Alignment Length:173 Identity:43/173 - (24%)
Similarity:74/173 - (42%) Gaps:23/173 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 VLTTPKYHKTRAIHVLRTW-GKRCNKIYFMTSEPDDELPTVVLTKPDRYEMLWGKTKEAF----- 161
            |.||.|:|::|...:|.|| .:...:.|..|...|:||...:.:...........:::|.     
Zfish   113 VKTTKKFHRSRLDLLLDTWISRNMQQTYIFTDGEDEELKKKIGSHAINTNCSAAHSRQALSCKMA 177

  Fly   162 VHIHEQMRHEADWFIKADDDTYLFLENLRYMLYPYSPETPIYFG---FNYKMVGTHQKNESYM-- 221
            |...:.:.....||...|||.|:..:.|..:|..|.....:|.|   .:..:..|.:..::.|  
Zfish   178 VEYDKFIESGKKWFCHVDDDNYVNTKTLVKLLSNYPHTQDMYIGKPSLDRPIEATERLGDNKMRP 242

  Fly   222 ------SGGSGYVLSRE-ALRI--FAEG---VNDTTKCRQEDD 252
                  :||:|:.:||. ||::  :|.|   :|...|.|..||
Zfish   243 VNFWFATGGAGFCISRGLALKMSPWASGGHFMNTAEKIRLPDD 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tgyNP_573349.4 Galactosyl_T 103..>270 CDD:473923 43/173 (25%)
lfngNP_571046.2 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 80..100
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.