DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment tgy and C16D9.6

DIOPT Version :10

Sequence 1:NP_573349.4 Gene:tgy / 32896 FlyBaseID:FBgn0030984 Length:373 Species:Drosophila melanogaster
Sequence 2:NP_505126.2 Gene:C16D9.6 / 182687 WormBaseID:WBGene00015861 Length:340 Species:Caenorhabditis elegans


Alignment Length:55 Identity:14/55 - (25%)
Similarity:20/55 - (36%) Gaps:13/55 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   258 CVALIIVPLAIVSTL---------FYADISILDNGLHFLLLIS----SQGAVNNL 299
            |:|.|...:|:...|         .|..|.:...|||.:..|.    |..|:..|
 Worm     6 CLAKITAGVAVGGALGGAVGAVYGTYEAIRVKVPGLHKVRFIGQTTLSSAAIFGL 60

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
tgyNP_573349.4 Galactosyl_T 103..>270 CDD:473923 4/11 (36%)
C16D9.6NP_505126.2 Galactosyl_T 98..>250 CDD:473923
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.