DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7423 and mtpn

DIOPT Version :9

Sequence 1:NP_573347.1 Gene:CG7423 / 32894 FlyBaseID:FBgn0030982 Length:124 Species:Drosophila melanogaster
Sequence 2:XP_021330653.1 Gene:mtpn / 406240 ZFINID:ZDB-GENE-040426-2166 Length:172 Species:Danio rerio


Alignment Length:122 Identity:60/122 - (49%)
Similarity:82/122 - (67%) Gaps:6/122 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGDGHKIEDIIWTIKNGVYDEVERIFLAGSLNVNDQM-GVRFPLHYAADFGQLKLLEFFVRIGAE 64
            |||    ::::|.:|||..|||:.| |..:.:||..: |.|.|||||||.||.::|||.:..||:
Zfish    55 MGD----KELMWALKNGDLDEVKNI-LVKAEDVNRTLEGGRKPLHYAADCGQAEMLEFLLSKGAD 114

  Fly    65 VDRKDKYGITPLLAAIWEGHTRCVEFLLRMGASRTERTPEGQSYAEAAEQEDIRRLL 121
            |:..||:||||||:|.:|||..||:.||..||.:..:.|:|.|..||||.|.|:.||
Zfish   115 VNAPDKHGITPLLSATYEGHVTCVKILLEKGADKNRKGPDGLSAFEAAESEAIKALL 171

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7423NP_573347.1 Ank_2 10..96 CDD:289560 44/86 (51%)
ANK 12..121 CDD:238125 55/109 (50%)
ANK repeat 37..69 CDD:293786 17/32 (53%)
ANK repeat 71..101 CDD:293786 16/29 (55%)
mtpnXP_021330653.1 ANK repeat 55..86 CDD:293786 14/35 (40%)
ANK 60..171 CDD:238125 55/111 (50%)
ANK repeat 88..119 CDD:293786 17/30 (57%)
ANK repeat 121..151 CDD:293786 16/29 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40607
Inparanoid 1 1.050 126 1.000 Inparanoid score I4668
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435166at2759
OrthoFinder 1 1.000 - - FOG0007179
OrthoInspector 1 1.000 - - otm26555
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4613
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.