DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7423 and mtpn

DIOPT Version :9

Sequence 1:NP_573347.1 Gene:CG7423 / 32894 FlyBaseID:FBgn0030982 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_989406.1 Gene:mtpn / 395043 XenbaseID:XB-GENE-1014016 Length:118 Species:Xenopus tropicalis


Alignment Length:122 Identity:55/122 - (45%)
Similarity:80/122 - (65%) Gaps:6/122 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MGDGHKIEDIIWTIKNGVYDEVERIFLAGSLNVNDQM-GVRFPLHYAADFGQLKLLEFFVRIGAE 64
            |||    ::.:|.||||..|.|:. |:.|..:||..: |.|.|:|||||.||.::|||.:..||.
 Frog     1 MGD----KEFVWAIKNGDLDAVKE-FVLGGEDVNRTLDGGRKPMHYAADCGQDEVLEFLLSKGAN 60

  Fly    65 VDRKDKYGITPLLAAIWEGHTRCVEFLLRMGASRTERTPEGQSYAEAAEQEDIRRLL 121
            ::..||:||||||:|.:|||.:|||.||..||.:|.:.|:|.:..|:.:.:.|:.||
 Frog    61 INAADKHGITPLLSACYEGHRKCVELLLSKGADKTVKGPDGLNALESTDNQAIKDLL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7423NP_573347.1 Ank_2 10..96 CDD:289560 43/86 (50%)
ANK 12..121 CDD:238125 50/109 (46%)
ANK repeat 37..69 CDD:293786 15/32 (47%)
ANK repeat 71..101 CDD:293786 18/29 (62%)
mtpnNP_989406.1 ANK repeat 1..32 CDD:293786 14/35 (40%)
ANK 1 1..30 13/33 (39%)
Ank_2 8..97 CDD:372319 46/89 (52%)
ANK repeat 34..65 CDD:293786 15/30 (50%)
ANK 2 34..65 15/30 (50%)
ANK 3 67..98 18/30 (60%)
ANK repeat 67..97 CDD:293786 18/29 (62%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40607
Inparanoid 1 1.050 121 1.000 Inparanoid score I4610
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435166at2759
OrthoFinder 1 1.000 - - FOG0007179
OrthoInspector 1 1.000 - - otm48723
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4613
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
87.970

Return to query results.
Submit another query.