DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7423 and CG31715

DIOPT Version :9

Sequence 1:NP_573347.1 Gene:CG7423 / 32894 FlyBaseID:FBgn0030982 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_723568.1 Gene:CG31715 / 318909 FlyBaseID:FBgn0051715 Length:121 Species:Drosophila melanogaster


Alignment Length:115 Identity:71/115 - (61%)
Similarity:94/115 - (81%) Gaps:0/115 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EDIIWTIKNGVYDEVERIFLAGSLNVNDQMGVRFPLHYAADFGQLKLLEFFVRIGAEVDRKDKYG 72
            ||||||||||.:|.|:..|...:..||:::..|||:|||||||||.:|||.:.:||:::||||:|
  Fly     7 EDIIWTIKNGEFDAVQDAFQNDAQKVNEEIKGRFPVHYAADFGQLNVLEFLISLGADINRKDKHG 71

  Fly    73 ITPLLAAIWEGHTRCVEFLLRMGASRTERTPEGQSYAEAAEQEDIRRLLA 122
            |||:|||||||||.|||.||:|||.:...||:||||.||||:::|::|||
  Fly    72 ITPILAAIWEGHTSCVELLLKMGADKNGSTPDGQSYLEAAEKDEIKKLLA 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7423NP_573347.1 Ank_2 10..96 CDD:289560 53/85 (62%)
ANK 12..121 CDD:238125 64/108 (59%)
ANK repeat 37..69 CDD:293786 18/31 (58%)
ANK repeat 71..101 CDD:293786 21/29 (72%)
CG31715NP_723568.1 Ank_2 9..98 CDD:289560 55/88 (63%)
ANK repeat 9..36 CDD:293786 13/26 (50%)
ANK 11..120 CDD:238125 64/108 (59%)
ANK repeat 38..68 CDD:293786 18/29 (62%)
ANK repeat 70..98 CDD:293786 21/27 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449678
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4214
Homologene 1 1.000 - - H40607
Inparanoid 1 1.050 126 1.000 Inparanoid score I4668
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435166at2759
OrthoFinder 1 1.000 - - FOG0007179
OrthoInspector 1 1.000 - - otm26555
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4613
98.800

Return to query results.
Submit another query.