DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7423 and Cdkn2a

DIOPT Version :9

Sequence 1:NP_573347.1 Gene:CG7423 / 32894 FlyBaseID:FBgn0030982 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_113738.1 Gene:Cdkn2a / 25163 RGDID:2323 Length:159 Species:Rattus norvegicus


Alignment Length:82 Identity:24/82 - (29%)
Similarity:36/82 - (43%) Gaps:2/82 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 NVNDQMGVRFPLHYAADFGQLKLLEFFVRIGAEVDRKDKYGITPLLAAIWEGHTRCVEFL--LRM 94
            |..|...:..|:|.||..|.|..|....:.||.:|.:|.:|..||..|:..||...|.:|  |..
  Rat    63 NCEDPTTLSRPVHDAAREGFLDTLVVLHQAGARLDVRDAWGRLPLDLALERGHHDVVRYLRYLLS 127

  Fly    95 GASRTERTPEGQSYAEA 111
            .|....|..:..::..:
  Rat   128 SAGNVSRVTDRHNFCSS 144

Known Domains:


Indicated by green bases in alignment.

Software error:

Illegal division by zero at /www/www.flyrnai.org/docroot/cgi-bin/DRSC_prot_align.pl line 591.

For help, please send mail to the webmaster (ritg@hms.harvard.edu), giving this error message and the time and date of the error.

GeneSequenceDomainRegion External IDIdentity
CG7423NP_573347.1 Ank_2 10..96 CDD:289560 22/65 (34%)
ANK 12..121 CDD:238125 24/82 (29%)
ANK repeat 37..69 CDD:293786 10/31 (32%)
ANK repeat 71..101 CDD:293786 10/31 (32%)
Cdkn2aNP_113738.1 ANK 1. /evidence=ECO:0000255 3..35
ANK 15..122 CDD:238125 20/58 (34%)
Ank_2 20..100 CDD:289560 12/36 (33%)
ANK repeat 36..66 CDD:293786 1/2 (50%)