DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7423 and mtpn-1

DIOPT Version :9

Sequence 1:NP_573347.1 Gene:CG7423 / 32894 FlyBaseID:FBgn0030982 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_001379799.1 Gene:mtpn-1 / 180545 WormBaseID:WBGene00016616 Length:114 Species:Caenorhabditis elegans


Alignment Length:112 Identity:46/112 - (41%)
Similarity:69/112 - (61%) Gaps:2/112 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    10 IIWTIKNGVYDEVERIFLAGSLNVNDQMGVRFPLHYAADFGQLKLLEFFVRIGAEVDRKDKYGIT 74
            :.|.::||..|.|::  .....||::....|..:..|||:||..::.:.:.|||.:..|||||||
 Worm     3 VAWNVQNGEIDAVKQ--SVNEKNVHEIYNGRTAIQIAADYGQTSIIAYLISIGANIQDKDKYGIT 65

  Fly    75 PLLAAIWEGHTRCVEFLLRMGASRTERTPEGQSYAEAAEQEDIRRLL 121
            |||:|:||||...|:.||:.||.|:...|:|.:..:..|:||||.||
 Worm    66 PLLSAVWEGHRDAVKLLLQNGADRSIHAPDGTALIDCTEEEDIRELL 112

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7423NP_573347.1 Ank_2 10..96 CDD:289560 34/85 (40%)
ANK 12..121 CDD:238125 44/108 (41%)
ANK repeat 37..69 CDD:293786 9/31 (29%)
ANK repeat 71..101 CDD:293786 18/29 (62%)
mtpn-1NP_001379799.1 Ank_2 7..88 CDD:403870 34/82 (41%)
ANK repeat 29..60 CDD:293786 9/30 (30%)
ANK repeat 62..91 CDD:293786 18/28 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160159590
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4214
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40607
Inparanoid 1 1.050 111 1.000 Inparanoid score I3443
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG53592
OrthoDB 1 1.010 - - D1435166at2759
OrthoFinder 1 1.000 - - FOG0007179
OrthoInspector 1 1.000 - - otm14721
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4613
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.810

Return to query results.
Submit another query.