DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7423 and ANKRD29

DIOPT Version :10

Sequence 1:NP_573347.1 Gene:CG7423 / 32894 FlyBaseID:FBgn0030982 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_775776.2 Gene:ANKRD29 / 147463 HGNCID:27110 Length:301 Species:Homo sapiens


Alignment Length:125 Identity:39/125 - (31%)
Similarity:59/125 - (47%) Gaps:6/125 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 DGHKIEDIIWTIKNGVYDEVERIFLAGS-LNVNDQMGVRFPLHYAADFGQLKLLEFFVRIGAEVD 66
            |.|....::.....|..|.|..:.|.|: :|:..:.|.. .|.:||..|...::.|....||..:
Human    43 DSHGTTLLMVAAYAGHIDCVRELVLQGADINLQRESGTT-ALFFAAQQGHNDVVRFLFGFGASTE 106

  Fly    67 RKDKYGITPLLAAIWEGHTRCVEFLLRMGASRTERTPEGQSYAEAAEQ----EDIRRLLA 122
            .:.|.|.|.||||...||.:.||.||:.||:..::..:|.:....|.|    :.||.|||
Human   107 FRTKDGGTALLAASQYGHMQVVETLLKHGANIHDQLYDGATALFLAAQGGYLDVIRLLLA 166

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7423NP_573347.1 ANKYR <1..>121 CDD:440430 36/122 (30%)
ANK repeat 37..69 CDD:293786 8/31 (26%)
ANK repeat 71..101 CDD:293786 14/29 (48%)
ANKRD29NP_775776.2 ANK repeat 9..43 CDD:293786 39/125 (31%)
ANK 1 11..41
ANKYR 12..232 CDD:440430 39/125 (31%)
ANK repeat 45..76 CDD:293786 7/30 (23%)
ANK 2 45..74 6/28 (21%)
ANK repeat 78..109 CDD:293786 8/31 (26%)
ANK 3 78..107 8/29 (28%)
ANK repeat 111..141 CDD:293786 14/29 (48%)
ANK 4 111..140 14/28 (50%)
ANK 5 144..173 8/23 (35%)
ANK repeat 144..172 CDD:293786 8/23 (35%)
ANK repeat 177..206 CDD:293786
ANK 6 177..206
ANK repeat 210..240 CDD:293786
ANK 7 210..239
TRPV 211..>292 CDD:454755
ANK repeat 242..273 CDD:293786
ANK 8 242..271
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.