DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7423 and ASB12

DIOPT Version :9

Sequence 1:	NP_573347.1	Gene:	CG7423 / 32894	FlyBaseID:	FBgn0030982	Length:	124	Species:	Drosophila melanogaster
Sequence 2:	NP_569059.3	Gene:	ASB12 / 142689	HGNCID:	19763	Length:	318	Species:	Homo sapiens

Alignment Length:	67	Identity:	28/67 - (41%)
Similarity:	33/67 - (49%)	Gaps:	5/67 - (7%)

- Green bases have known domain annotations that are detailed below.

  Fly    42 PLHYAADFGQLKLLEFFVRIGAEVDRKDKYGITPLLAAIWEGHTRCVEFLLRMGASRTERTPEGQ 106
            ||..||.:|.|..|:..:..||:||..|....|||..|:..||..||..||..|||     |.|.
Human    76 PLRLAASYGHLSCLQVLLAHGADVDSLDVKAQTPLFTAVSHGHLDCVRVLLEAGAS-----PGGS 135

  Fly   107 SY 108
            .|
Human   136 IY 137

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7423	NP_573347.1	Ank_2	10..96	CDD:289560	22/53 (42%)
		ANK	12..121	CDD:238125	28/67 (42%)
		ANK repeat	37..69	CDD:293786	11/26 (42%)
		ANK repeat	71..101	CDD:293786	13/29 (45%)
ASB12	NP_569059.3	Ank_2	8..103	CDD:289560	11/26 (42%)
		ANK	75..201	CDD:238125	28/67 (42%)
		ANK repeat	75..103	CDD:293786	11/26 (42%)
		Ank_2	77..168	CDD:289560	27/66 (41%)
		ANK repeat	105..136	CDD:293786	15/35 (43%)
		ANK repeat	138..168	CDD:293786	28/67 (42%)
		ANK repeat	182..208	CDD:293786
		ANK	184..>250	CDD:238125
		Ank_2	185..>250	CDD:289560
		SOCS_box	277..315	CDD:284857
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	0	0.000