Sequence 1: | NP_573347.1 | Gene: | CG7423 / 32894 | FlyBaseID: | FBgn0030982 | Length: | 124 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_665807.1 | Gene: | MTPN / 136319 | HGNCID: | 15667 | Length: | 118 | Species: | Homo sapiens |
Alignment Length: | 115 | Identity: | 52/115 - (45%) |
---|---|---|---|
Similarity: | 79/115 - (68%) | Gaps: | 2/115 - (1%) |
- Green bases have known domain annotations that are detailed below.
Fly 8 EDIIWTIKNGVYDEVERIFLAGSLNVNDQM-GVRFPLHYAADFGQLKLLEFFVRIGAEVDRKDKY 71
Fly 72 GITPLLAAIWEGHTRCVEFLLRMGASRTERTPEGQSYAEAAEQEDIRRLL 121 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7423 | NP_573347.1 | Ank_2 | 10..96 | CDD:289560 | 42/86 (49%) |
ANK | 12..121 | CDD:238125 | 50/109 (46%) | ||
ANK repeat | 37..69 | CDD:293786 | 17/32 (53%) | ||
ANK repeat | 71..101 | CDD:293786 | 16/29 (55%) | ||
MTPN | NP_665807.1 | ANK 1 | 2..30 | 9/26 (35%) | |
Ank_2 | 6..97 | CDD:403870 | 45/91 (49%) | ||
ANK repeat | 6..32 | CDD:293786 | 10/26 (38%) | ||
ANK 2 | 34..66 | 17/31 (55%) | |||
ANK repeat | 34..65 | CDD:293786 | 17/30 (57%) | ||
ANK 3 | 67..99 | 16/31 (52%) | |||
ANK repeat | 67..97 | CDD:293786 | 16/29 (55%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 1 | 0.900 | - | - | E2759_KOG4214 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 1 | 1.000 | - | - | H40607 | |
Inparanoid | 1 | 1.050 | 119 | 1.000 | Inparanoid score | I4787 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1435166at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0007179 | |
OrthoInspector | 1 | 1.000 | - | - | otm41510 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 1 | 1.000 | - | - | X4613 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
9 | 8.870 |