DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7423 and MTPN

DIOPT Version :9

Sequence 1:NP_573347.1 Gene:CG7423 / 32894 FlyBaseID:FBgn0030982 Length:124 Species:Drosophila melanogaster
Sequence 2:NP_665807.1 Gene:MTPN / 136319 HGNCID:15667 Length:118 Species:Homo sapiens


Alignment Length:115 Identity:52/115 - (45%)
Similarity:79/115 - (68%) Gaps:2/115 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EDIIWTIKNGVYDEVERIFLAGSLNVNDQM-GVRFPLHYAADFGQLKLLEFFVRIGAEVDRKDKY 71
            ::.:|.:|||..||| :.::|...:||..: |.|.|||||||.|||::|||.:..||:::..||:
Human     4 KEFMWALKNGDLDEV-KDYVAKGEDVNRTLEGGRKPLHYAADCGQLEILEFLLLKGADINAPDKH 67

  Fly    72 GITPLLAAIWEGHTRCVEFLLRMGASRTERTPEGQSYAEAAEQEDIRRLL 121
            .|||||:|::|||..||:.||..||.:|.:.|:|.:..||.:.:.|:.||
Human    68 HITPLLSAVYEGHVSCVKLLLSKGADKTVKGPDGLTAFEATDNQAIKALL 117

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7423NP_573347.1 Ank_2 10..96 CDD:289560 42/86 (49%)
ANK 12..121 CDD:238125 50/109 (46%)
ANK repeat 37..69 CDD:293786 17/32 (53%)
ANK repeat 71..101 CDD:293786 16/29 (55%)
MTPNNP_665807.1 ANK 1 2..30 9/26 (35%)
Ank_2 6..97 CDD:403870 45/91 (49%)
ANK repeat 6..32 CDD:293786 10/26 (38%)
ANK 2 34..66 17/31 (55%)
ANK repeat 34..65 CDD:293786 17/30 (57%)
ANK 3 67..99 16/31 (52%)
ANK repeat 67..97 CDD:293786 16/29 (55%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG4214
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H40607
Inparanoid 1 1.050 119 1.000 Inparanoid score I4787
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435166at2759
OrthoFinder 1 1.000 - - FOG0007179
OrthoInspector 1 1.000 - - otm41510
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X4613
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
98.870

Return to query results.
Submit another query.