DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment CG7423 and CDKN2A

DIOPT Version :9

Sequence 1:	NP_573347.1	Gene:	CG7423 / 32894	FlyBaseID:	FBgn0030982	Length:	124	Species:	Drosophila melanogaster
Sequence 2:	XP_011515977.1	Gene:	CDKN2A / 1029	HGNCID:	1787	Length:	184	Species:	Homo sapiens

Alignment Length:	94	Identity:	33/94 - (35%)
Similarity:	44/94 - (46%)	Gaps:	8/94 - (8%)

- Green bases have known domain annotations that are detailed below.

  Fly    23 ERIFLAGS-LNVNDQMGVRFPLHYAADFGQLKLLEFFVRIGAEVDRKDKYGITPLLAAIWEGHTR 86
            |.:.|.|: .|..|...:..|:|.||..|.|..|....|.||.:|.:|.:|..|:..|...|| |
Human    61 ELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGH-R 124

  Fly    87 CVEFLLRMGASRTERTPEGQSYA--EAAE 113
            .|...||..|..|    .|.::|  :|||
Human   125 DVARYLRAAAGGT----RGSNHARIDAAE 149

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
CG7423	NP_573347.1	Ank_2	10..96	CDD:289560	26/73 (36%)
		ANK	12..121	CDD:238125	33/94 (35%)
		ANK repeat	37..69	CDD:293786	11/31 (35%)
		ANK repeat	71..101	CDD:293786	11/29 (38%)
CDKN2A	XP_011515977.1	Ank_2	16..108	CDD:289560	16/46 (35%)
		ANK repeat	16..42	CDD:293786
		ANK	19..130	CDD:238125	24/69 (35%)
		ANK repeat	44..74	CDD:293786	4/12 (33%)
		ANK repeat	76..108	CDD:293786	11/31 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	0	0.000	Not matched by this tool.
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	1	1.010	-	-		D1435166at2759
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	0	0.000	Not matched by this tool.
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	1	1.010