DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7423 and cdkn2a/b

DIOPT Version :9

Sequence 1:NP_573347.1 Gene:CG7423 / 32894 FlyBaseID:FBgn0030982 Length:124 Species:Drosophila melanogaster
Sequence 2:XP_002660514.1 Gene:cdkn2a/b / 100329528 ZFINID:ZDB-GENE-081104-306 Length:125 Species:Danio rerio


Alignment Length:109 Identity:27/109 - (24%)
Similarity:43/109 - (39%) Gaps:21/109 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 IEDIIWTIKNGVYDEVE--------RIFLAGSL-------------NVNDQMGVRFPLHYAADFG 50
            |..:.:.:.|||...|.        ::.:.|:.             ||.|......|||.||..|
Zfish    17 ISHVQFLLSNGVNANVVNKFRRTPIQVMMMGNAPLALVLLEQGADPNVPDPDTGSTPLHDAARTG 81

  Fly    51 QLKLLEFFVRIGAEVDRKDKYGITPLLAAIWEGHTRCVEFLLRM 94
            .:..:...:|.||:.:.||...:.|:..|...|:...||.|.|:
Zfish    82 FIDTVRLLIRFGADPNTKDHCDLRPVDVAQQTGNVDVVELLNRV 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7423NP_573347.1 Ank_2 10..96 CDD:289560 26/106 (25%)
ANK 12..121 CDD:238125 26/104 (25%)
ANK repeat 37..69 CDD:293786 9/31 (29%)
ANK repeat 71..101 CDD:293786 7/24 (29%)
cdkn2a/bXP_002660514.1 ANK 8..122 CDD:238125 25/104 (24%)
Ank_2 8..100 CDD:289560 18/82 (22%)
ANK repeat 36..66 CDD:293786 3/29 (10%)
ANK repeat 68..100 CDD:293786 9/31 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1435166at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.