Sequence 1: | NP_001285421.1 | Gene: | CG7378 / 32888 | FlyBaseID: | FBgn0030976 | Length: | 235 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001073895.1 | Gene: | STYXL2 / 92235 | HGNCID: | 25034 | Length: | 1158 | Species: | Homo sapiens |
Alignment Length: | 272 | Identity: | 84/272 - (30%) |
---|---|---|---|
Similarity: | 128/272 - (47%) | Gaps: | 72/272 - (26%) |
- Green bases have known domain annotations that are detailed below.
Fly 23 HYYQSPSRLE---TSEQTTGRQLQRVLHYSMAPSRAL--------PGLRR-AEC----------- 64
Fly 65 ---------------AIHDVDC--------------------DEVYPGIYIGDAAAAKNKTYLRL 94
Fly 95 MGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKF 159
Fly 160 IDSA-ISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRDIRPNDGFLQQLADL 223
Fly 224 DMELKRKNLYPY 235 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG7378 | NP_001285421.1 | DUSP3-like | 71..227 | CDD:350365 | 66/176 (38%) |
STYXL2 | NP_001073895.1 | Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 1..21 | ||
DSPc | 133..275 | CDD:238073 | 64/154 (42%) | ||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 280..303 | 1/7 (14%) | |||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 315..337 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 360..392 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 407..444 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 492..527 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 559..582 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 597..622 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 873..915 | ||||
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite | 940..1135 | ||||
Blue background indicates that the domain is not in the aligned region. |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 1 | 1.000 | 123 | 1.000 | Domainoid score | I5579 |
eggNOG | 1 | 0.900 | - | - | E2759_KOG1716 | |
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 1 | 1.010 | - | - | D1576308at2759 | |
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 1 | 1.000 | - | - | otm41148 | |
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 1 | 1.100 | - | - | O | PTHR45682 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
6 | 5.920 |