DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and STYXL2

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001073895.1 Gene:STYXL2 / 92235 HGNCID:25034 Length:1158 Species:Homo sapiens


Alignment Length:272 Identity:84/272 - (30%)
Similarity:128/272 - (47%) Gaps:72/272 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 HYYQSPSRLE---TSEQTTGRQLQRVLHYSMAPSRAL--------PGLRR-AEC----------- 64
            ||.:|||..:   .|:..|.......:|.|.|.:...        ||:|. |||           
Human    28 HYLRSPSPSQYSMVSDAETESIFMEPIHLSSAIAAKQIINEELKPPGVRADAECPGMLESAEQLL 92

  Fly    65 ---------------AIHDVDC--------------------DEVYPGIYIGDAAAAKNKTYLRL 94
                           ::::..|                    |||:|.::|.:.:.|.||..|:.
Human    93 VEDLYNRVREKMDDTSLYNTPCVLDLQRALVQDRQEAPWNEVDEVWPNVFIAEKSVAVNKGRLKR 157

  Fly    95 MGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPMVDAPTTDISRYFYVASKF 159
            :||||:||||.|.   .|.||..:|..:.          .:|:|..:.|.|..|||::|..||:|
Human   158 LGITHILNAAHGT---GVYTGPEFYTGLE----------IQYLGVEVDDFPEVDISQHFRKASEF 209

  Fly   160 IDSA-ISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRRDIRPNDGFLQQLADL 223
            :|.| ::..||:||...:|:||||..|:|||||...|:.::|:.|||.:|.|.||:|||:||.:|
Human   210 LDEALLTYRGKVLVSSEMGISRSAVLVVAYLMIFHNMAILEALMTVRKKRAIYPNEGFLKQLREL 274

  Fly   224 DMELKRKNLYPY 235
            :.:|..:....|
Human   275 NEKLMEEREEDY 286

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 66/176 (38%)
STYXL2NP_001073895.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..21
DSPc 133..275 CDD:238073 64/154 (42%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 280..303 1/7 (14%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 315..337
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 360..392
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 407..444
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 492..527
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 559..582
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 597..622
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 873..915
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 940..1135
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 123 1.000 Domainoid score I5579
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 1 1.000 - - otm41148
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR45682
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
65.920

Return to query results.
Submit another query.