DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and YVH1

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_012292.3 Gene:YVH1 / 854844 SGDID:S000001465 Length:364 Species:Saccharomyces cerevisiae


Alignment Length:177 Identity:43/177 - (24%)
Similarity:75/177 - (42%) Gaps:45/177 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    68 DVDCDEVYPGIYIGDAAAAKNKTYLRLMG----ITHVLNAAEGCRYGQVDTGHSYYRDMPS--IR 126
            |.:...:..|||:|......:.   |.:|    |||:|:..:             ::.:|.  ||
Yeast     9 DEEVTRILGGIYLGGIRPIIDH---RPLGAEFNITHILSVIK-------------FQVIPEYLIR 57

  Fly   127 RSHKDCVFRYMGFPMVDAPTTDISRYFYVASKFIDSAI-----------------SSGGKILVHC 174
            :.     :.....|:.|...||:.:||...::|||..:                 ...|.:..||
Yeast    58 KG-----YTLKNIPIDDDDVTDVLQYFDETNRFIDQCLFPNEVEYSPRLVDFKKKPQRGAVFAHC 117

  Fly   175 LVGMSRSATCVLAYLMICRKMSAVDAIRTVRMRR-DIRPNDGFLQQL 220
            ..|:|||.|.::||||....:|...|:..|:.:: .:.||:.|::||
Yeast   118 QAGLSRSVTFIVAYLMYRYGLSLSMAMHAVKRKKPSVEPNENFMEQL 164

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 42/174 (24%)
YVH1NP_012292.3 DSP_fungal_YVH1 12..173 CDD:350368 42/174 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.