DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and SDP1

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_012153.1 Gene:SDP1 / 854693 SGDID:S000001375 Length:209 Species:Saccharomyces cerevisiae


Alignment Length:222 Identity:53/222 - (23%)
Similarity:87/222 - (39%) Gaps:50/222 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 SPHYYQSPS--RLETSEQTTGRQLQRVLHYSMAPSRALPGLRRAECAIHDVDCDEVYPGIYIGDA 83
            :|...|.||  .|.|.|::|.::              .|...|.......:|...:||.   |..
Yeast    14 APKSGQRPSLPMLATDERSTDKE--------------SPNEDREFVPCSSLDVRRIYPK---GPL 61

  Fly    84 AAAKNKTYL-------RLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYMGFPM 141
            .....|.||       .|:....|:|.||        ..:.....:|::...|    :|:.....
Yeast    62 LVLPEKIYLYSEPTVKELLPFDVVINVAE--------EANDLRMQVPAVEYHH----YRWEHDSQ 114

  Fly   142 V--DAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIRTV 204
            :  |.|:         .:..|.:|.:...|||:||..|:|||||.::||:|....:|...:...:
Yeast   115 IALDLPS---------LTSIIHAATTKREKILIHCQCGLSRSATLIIAYIMKYHNLSLRHSYDLL 170

  Fly   205 RMRRD-IRPNDGFLQQLADLDMELKRK 230
            :.|.| |.|:.|.:.||.:.::.|..|
Yeast   171 KSRADKINPSIGLIFQLMEWEVALNAK 197

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 40/165 (24%)
SDP1NP_012153.1 DSP_fungal_SDP1-like 56..194 CDD:350371 40/161 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.860

Return to query results.
Submit another query.