DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and SSH2

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_001269058.1 Gene:SSH2 / 85464 HGNCID:30580 Length:1450 Species:Homo sapiens


Alignment Length:151 Identity:44/151 - (29%)
Similarity:73/151 - (48%) Gaps:20/151 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    73 EVYPGIYIGDAAAAKNKTYLRLMGITHVLNAAEGCRYGQVDTGHSYYRDMPSIRRSHKDCVFRYM 137
            :::..:::|....|.|...|:..|:.::||...     ::|   :::   |.        ||.|.
Human   337 QIFEHVFLGSEWNASNLEDLQNRGVRYILNVTR-----EID---NFF---PG--------VFEYH 382

  Fly   138 GFPMVDAPTTDISRYFYVASKFIDSAISSGGKILVHCLVGMSRSATCVLAYLMICRKMSAVDAIR 202
            ...:.|...||:..|:....|||..|...|.|.||||.:|:||||:.|:||.|.....:...|..
Human   383 NIRVYDEEATDLLAYWNDTYKFISKAKKHGSKCLVHCKMGVSRSASTVIAYAMKEYGWNLDRAYD 447

  Fly   203 TVRMRRDI-RPNDGFLQQLAD 222
            .|:.||.: :||..|::||.:
Human   448 YVKERRTVTKPNPSFMRQLEE 468

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 44/151 (29%)
SSH2NP_001269058.1 SSH-N 38..263 CDD:212166
DEK_C 278..329 CDD:285919
DSPc 335..470 CDD:238073 44/151 (29%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 644..668
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 691..711
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 723..755
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 824..852
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 867..889
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 904..981
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 989..1008
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1046..1068
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1097..1135
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1171..1206
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1576308at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.