DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG7378 and PPS1

DIOPT Version :9

Sequence 1:NP_001285421.1 Gene:CG7378 / 32888 FlyBaseID:FBgn0030976 Length:235 Species:Drosophila melanogaster
Sequence 2:NP_009835.3 Gene:PPS1 / 852579 SGDID:S000000480 Length:807 Species:Saccharomyces cerevisiae


Alignment Length:183 Identity:47/183 - (25%)
Similarity:76/183 - (41%) Gaps:41/183 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly    78 IYIGDAAAAKNKTYLRLMGITHVLNAAEGCRY--------------------------GQVDTGH 116
            :|:|....|:|...|:.:||||:::..|...:                          |......
Yeast   593 LYLGSLDHAQNPALLKSLGITHIVSVGEVVSWTLNKDKIAHPVRPHRAITMTNTNEVAGNTTCNK 657

  Fly   117 SYYRDMPSIRRSHKD----CVFRYMGFPMVDAPTTDIS---RYFYVASK---FIDSAISSGGKIL 171
            |..|....:....::    .:....||.:......|.:   ..|:...|   ||.::.::|||:|
Yeast   658 SRNRADTVVSDKQENGSNVVISENSGFQICQIENLDDNGKDPLFHQIDKVLDFISNSEATGGKVL 722

  Fly   172 VHCLVGMSRSATCVLA----YLMICRKMSAVDAIRTVRMRRDIRPNDGFLQQL 220
            |||:||:|||||..:|    ||. |...||...:|..|:...|:||..|:.:|
Yeast   723 VHCMVGVSRSATVCIAECMRYLQ-CDLASAYLFVRVRRLNVIIQPNLFFVYEL 774

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG7378NP_001285421.1 DUSP3-like 71..227 CDD:350365 47/183 (26%)
PPS1NP_009835.3 DSP_fungal_PPS1 580..779 CDD:350366 47/183 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E2759_KOG1716
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X520
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.